(data stored in SCRATCH zone)

EMBL: CP001875.DNAN

CP001875.DNAN        Location/Qualifiers
FT   CDS             complement(95034..96257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PANA_0089"
FT                   /product="DnaN"
FT                   /note="DNA polymerase III beta subunit; Similar to Pantoea
FT                   sp. At-9b, DNA polymerase III, beta subunit (NCBI:
FT                   ZP_05729636.1); COG: DNA replication, recombination and
FT                   repair; Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75256"
FT                   /db_xref="GOA:D4GGF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGF5"
FT                   /protein_id="ADD75256.1"
FT                   /translation="MVVATIPRYFTLAVRLSNCVKKATTSKKISQISSEHYLRDAMKFI
FT                   VEREQLLKPLQQVSGPLGGRPTLPILGNLLMQVNEGSLLLTGTDLEMEMVARVALTQPH
FT                   ETGATTVPARKFLDICRGLPEGAEINVTLEGERMLVRSGRSRFSLSTLPASDFPNLDDW
FT                   QNEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMMFETEGEELRTVATDGHRLAVCS
FT                   MPIGQALPSHSVIVPRKGVIELLRLLDGGDTPLQVQIGSSNIRAHVGDYIFTSKLVDGR
FT                   FPDYRRVLPKNPDKALEAGCDLLKQAFARAAILSNEKFRGVRLHITENQLKITANNPEQ
FT                   EEAEEMLDVSYTGSELEIGFNVSYVLDVLNALKCENVRLLLTDSVSSVQIEDVVSPAAA
FT                   YVVMPMRL"
     MVVATIPRYF TLAVRLSNCV KKATTSKKIS QISSEHYLRD AMKFIVEREQ LLKPLQQVSG        60
     PLGGRPTLPI LGNLLMQVNE GSLLLTGTDL EMEMVARVAL TQPHETGATT VPARKFLDIC       120
     RGLPEGAEIN VTLEGERMLV RSGRSRFSLS TLPASDFPNL DDWQNEVEFT LPQATLKRLI       180
     EATQFSMAHQ DVRYYLNGMM FETEGEELRT VATDGHRLAV CSMPIGQALP SHSVIVPRKG       240
     VIELLRLLDG GDTPLQVQIG SSNIRAHVGD YIFTSKLVDG RFPDYRRVLP KNPDKALEAG       300
     CDLLKQAFAR AAILSNEKFR GVRLHITENQ LKITANNPEQ EEAEEMLDVS YTGSELEIGF       360
     NVSYVLDVLN ALKCENVRLL LTDSVSSVQI EDVVSPAAAY VVMPMRL                     407
//

If you have problems or comments...

PBIL Back to PBIL home page