(data stored in SCRATCH zone)

EMBL: CP001875.FDHE

CP001875.FDHE        Location/Qualifiers
FT   CDS             complement(113067..114308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhE"
FT                   /locus_tag="PANA_0105"
FT                   /product="FdhE"
FT                   /note="Protein FdhE; Similar to Pantoea sp. At-9b, formate
FT                   dehydrogenase accessory protein FdhE (NCBI: ZP_05729704.1);
FT                   COG: Posttranslational modification, protein turnover,
FT                   chaperones; Subcellular localization as predicted by Psort
FT                   2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75272"
FT                   /db_xref="GOA:D4GGH1"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGH1"
FT                   /protein_id="ADD75272.1"
FT                   /translation="MKWRTAGPACSMSICMKSSSLGKNTFHPQGRDLDCYDQPVGNIDE
FT                   ILKCCNLLTDDESCHDGDNRNRKNVKPATKPPSEWPEPRLKTYSCWCRESRNQPTKQEN
FT                   ALYEHPHYPARSVGEERKKPSGDNPAVTFPQLKRLYSRRAARLRDLAAKNPLGDYLRFA
FT                   AVIAQAQEIVLYDHPLQMNLHARLVQSAQEGKPPLDIHTLPRDTHWHRLLHSLIAELKP
FT                   EMSGQALAVLENLEKASASELETMASALFAGEYAQVSSDKAPFIWASLSIYWAQMAALI
FT                   PGKAQAEMGNQRQYCPVCNSMPVASMVHMGTDEGARYLHCNLCESEWYVVRSKCTNCEQ
FT                   SRDLHYWSLDSEHAAVKAESCGDCGSYLKILYQQKNPAIEPVADDLASLVLDARMEQEG
FT                   FTRSSLNPFMFPGE"
     MKWRTAGPAC SMSICMKSSS LGKNTFHPQG RDLDCYDQPV GNIDEILKCC NLLTDDESCH        60
     DGDNRNRKNV KPATKPPSEW PEPRLKTYSC WCRESRNQPT KQENALYEHP HYPARSVGEE       120
     RKKPSGDNPA VTFPQLKRLY SRRAARLRDL AAKNPLGDYL RFAAVIAQAQ EIVLYDHPLQ       180
     MNLHARLVQS AQEGKPPLDI HTLPRDTHWH RLLHSLIAEL KPEMSGQALA VLENLEKASA       240
     SELETMASAL FAGEYAQVSS DKAPFIWASL SIYWAQMAAL IPGKAQAEMG NQRQYCPVCN       300
     SMPVASMVHM GTDEGARYLH CNLCESEWYV VRSKCTNCEQ SRDLHYWSLD SEHAAVKAES       360
     CGDCGSYLKI LYQQKNPAIE PVADDLASLV LDARMEQEGF TRSSLNPFMF PGE              413
//

If you have problems or comments...

PBIL Back to PBIL home page