(data stored in SCRATCH zone)

EMBL: CP001875.HUPA

CP001875.HUPA        Location/Qualifiers
FT   CDS             268007..268279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="PANA_0225"
FT                   /product="HupA"
FT                   /note="DNA-binding protein HU-alpha; Similar to Erwinia
FT                   tasmaniensis Et1/99, transcriptional regulator HU subunit
FT                   alpha (NCBI: YP_001906131.1); COG: DNA replication,
FT                   recombination and repair; Subcellular localization as
FT                   predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75392"
FT                   /db_xref="GOA:D4GH77"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D4GH77"
FT                   /protein_id="ADD75392.1"
FT                   /translation="MNKTQLIDVIAEKADLSKTQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     MNKTQLIDVI AEKADLSKTQ AKAALESTLA AITESLKEGD AVQLVGFGTF KVNHRAERTG        60
     RNPQTGKEIK IAAANVPAFV SGKALKDAVK                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page