(data stored in SCRATCH zone)

EMBL: CP001875.IUTA

CP001875.IUTA        Location/Qualifiers
FT   CDS             425218..427413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iutA"
FT                   /locus_tag="PANA_0354"
FT                   /product="IutA"
FT                   /note="Ferric aerobactin receptor precursor; Similar to
FT                   Pectobacterium atrosepticum SCRI1043, TonB-dependent ferric
FT                   aerobactin receptor (NCBI: YP_048985.1); COG: Inorganic ion
FT                   transport and metabolism; Subcellular localization as
FT                   predicted by Psort 2.0: Outer Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75521"
FT                   /db_xref="GOA:D4GHZ1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHZ1"
FT                   /protein_id="ADD75521.1"
FT                   /translation="MKTKNKNIWLLNPLLLAMMAPAVAQQTSENDMVVSASRTHRTVAE
FT                   MAQTTWVIEGAELEQQVQGGKEFKDALAQLVPGLDVSSQGRTNYGMNMRGRAIVVLVDG
FT                   VRLNSSRTDSRQLDSIDPFNIDHIEVISGSTSLYGGGSTGGLINIVTKKGQPGTQFEFE
FT                   TGTKTGFNNSKDHDERVAGAISGGNDRASGRLSVAYQKFGGWYDGNGDSVLLDNTQTGL
FT                   QYSDRLDVMGTGTLEIDDHQQLQLVTQYYKSQGDDDYGLYLGRNFSAVTGNGNAYTSKG
FT                   LNSDRIPGTERHLVSLQYSNTDFLGQELVGQVYYRDESLAFYPFPTVSGGRVTSLSSSK
FT                   QDTDQYGGKLAITSKPLDNLQLTYGVDADHERFSSNQMFFDLAQSAASGGLNNQSIYTT
FT                   GRYPGYDITNLAAFLQSSYDINDTFTLSGGVRYQYTENKVDDFVGYAQQQAIANGTARS
FT                   ADAIPGGSTDYDNVLYNAGILMHITERQQAWFNFSQGVELPDPGKYYGNGTYRLQNGNY
FT                   QLLNSVNVDQSKLQGIKVDSYELGWRYTGNDLRTQLAAYYSLSDKSISVNRSDMTINVD
FT                   DDKRRIYGVEGAVDYFIPDTNWSTGVNFNLVKSETKKDGGWKKWDVIYASPSKATAYVG
FT                   WSPDPWSLRLQSTQSFDLTDNGGNKIDGYTTVDFIGSYQLPVGKLSFSVENLLDRDYTT
FT                   VWGQRAPLLYSPTYGSPSLFQYKGRGRTFGLNYSVLF"
     MKTKNKNIWL LNPLLLAMMA PAVAQQTSEN DMVVSASRTH RTVAEMAQTT WVIEGAELEQ        60
     QVQGGKEFKD ALAQLVPGLD VSSQGRTNYG MNMRGRAIVV LVDGVRLNSS RTDSRQLDSI       120
     DPFNIDHIEV ISGSTSLYGG GSTGGLINIV TKKGQPGTQF EFETGTKTGF NNSKDHDERV       180
     AGAISGGNDR ASGRLSVAYQ KFGGWYDGNG DSVLLDNTQT GLQYSDRLDV MGTGTLEIDD       240
     HQQLQLVTQY YKSQGDDDYG LYLGRNFSAV TGNGNAYTSK GLNSDRIPGT ERHLVSLQYS       300
     NTDFLGQELV GQVYYRDESL AFYPFPTVSG GRVTSLSSSK QDTDQYGGKL AITSKPLDNL       360
     QLTYGVDADH ERFSSNQMFF DLAQSAASGG LNNQSIYTTG RYPGYDITNL AAFLQSSYDI       420
     NDTFTLSGGV RYQYTENKVD DFVGYAQQQA IANGTARSAD AIPGGSTDYD NVLYNAGILM       480
     HITERQQAWF NFSQGVELPD PGKYYGNGTY RLQNGNYQLL NSVNVDQSKL QGIKVDSYEL       540
     GWRYTGNDLR TQLAAYYSLS DKSISVNRSD MTINVDDDKR RIYGVEGAVD YFIPDTNWST       600
     GVNFNLVKSE TKKDGGWKKW DVIYASPSKA TAYVGWSPDP WSLRLQSTQS FDLTDNGGNK       660
     IDGYTTVDFI GSYQLPVGKL SFSVENLLDR DYTTVWGQRA PLLYSPTYGS PSLFQYKGRG       720
     RTFGLNYSVL F                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page