(data stored in SCRATCH zone)

EMBL: CP001875.LACZ

CP001875.LACZ        Location/Qualifiers
FT   CDS             399440..402526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="PANA_0331"
FT                   /product="LacZ"
FT                   /note="Beta-galactosidase; Similar to Citrobacter youngae
FT                   ATCC 29220, hypothetical protein CIT292_01323 (NCBI:
FT                   ZP_03835551.1); COG: Carbohydrate transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75498"
FT                   /db_xref="GOA:D4GHI3"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHI3"
FT                   /protein_id="ADD75498.1"
FT                   /translation="MTLDRDSLAAVLARRDWENPGVSEHNRLEAHPPFYSWRSAEAAHN
FT                   NAPSAQRKSLSGEWTFAFFPAPEAVPDSWRTQDLQAAATITVPSVWQMQGYDVPIYTNV
FT                   TYPIPVDPPRVPAENPTGCYSLTFNVDADWLQHGQTRIIFDGVNSAFYLWCNGRWVGYG
FT                   QDSRLPSEFDLSEFLREGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPASH
FT                   LRDLRIRTHFNDDFSRARLEAEVRVAGALDDDLRVSVQLFAGDTLTGEATSPLGSAIID
FT                   ERGAWSDRTTLCINVANPALWSAETPHLYRAVVQLHRTDGTLIEAEACDVGFRHVSIEN
FT                   GLLLLNGQPLLIRGTNRHEHHPERGQVMDRDTMVQDILLMKQNNFNAVRCSHYPNDPLW
FT                   YSLCDHYGLYVVDEANIETHGMVPMNRLSDDPVWLPAMSQRVTRMVQRDRNHPCIIIWS
FT                   LGNESGHGANHDALYRWLKSEDPSRPVQYEGGGANTAATDIICPMYARVDEDQPFPAVP
FT                   KWSIKKWLSMPGEQRPLILCEYAHAMGNSLGGYAKYWQAFRQYPRLQGGFVWDWVDQSL
FT                   IKYDDNGEPWAAYGGDFGDTPNDRQFCMNGLVFADRTPHPSLYEARHAQQFFQFRLLPG
FT                   SERTLEVTSEYLFRHSDNEILHWSVAQDGNLLAAGEVTLDIAPQGRQQIALPEVPLPQS
FT                   AGQLWLTVRVEQPQPTAWSEAGHISAWQQWPLEAILNVALPPQAASAPQLSRGEDTFSV
FT                   AVNNQRWAFSRQQGVLTQYWIDDQPQLLSPLRDQFTRAPLDNDIGVSEVTRIDPNAWVE
FT                   RWKAAGHYQSEVTTLQCTAEALSDAVVINTVHAWQFQGKTLFISRKAYRIDGFGEMAVT
FT                   VNVEIASGTPYPARIGMSCQLTQIVERVNWLGLGPHENYPDRLTSACFDRWGLPLSEMY
FT                   TPYVFPTENGLRCGTRELNYGAHQWRGDFQFNISRYSQTQLMETCHRHLLRPEAGTWLN
FT                   IDGFHMGVGGDDSWSPSVSPEFLLSAGRYSYQFIWGQQK"
     MTLDRDSLAA VLARRDWENP GVSEHNRLEA HPPFYSWRSA EAAHNNAPSA QRKSLSGEWT        60
     FAFFPAPEAV PDSWRTQDLQ AAATITVPSV WQMQGYDVPI YTNVTYPIPV DPPRVPAENP       120
     TGCYSLTFNV DADWLQHGQT RIIFDGVNSA FYLWCNGRWV GYGQDSRLPS EFDLSEFLRE       180
     GENRLAVMVL RWSDGSYLED QDMWRMSGIF RDVSLLHKPA SHLRDLRIRT HFNDDFSRAR       240
     LEAEVRVAGA LDDDLRVSVQ LFAGDTLTGE ATSPLGSAII DERGAWSDRT TLCINVANPA       300
     LWSAETPHLY RAVVQLHRTD GTLIEAEACD VGFRHVSIEN GLLLLNGQPL LIRGTNRHEH       360
     HPERGQVMDR DTMVQDILLM KQNNFNAVRC SHYPNDPLWY SLCDHYGLYV VDEANIETHG       420
     MVPMNRLSDD PVWLPAMSQR VTRMVQRDRN HPCIIIWSLG NESGHGANHD ALYRWLKSED       480
     PSRPVQYEGG GANTAATDII CPMYARVDED QPFPAVPKWS IKKWLSMPGE QRPLILCEYA       540
     HAMGNSLGGY AKYWQAFRQY PRLQGGFVWD WVDQSLIKYD DNGEPWAAYG GDFGDTPNDR       600
     QFCMNGLVFA DRTPHPSLYE ARHAQQFFQF RLLPGSERTL EVTSEYLFRH SDNEILHWSV       660
     AQDGNLLAAG EVTLDIAPQG RQQIALPEVP LPQSAGQLWL TVRVEQPQPT AWSEAGHISA       720
     WQQWPLEAIL NVALPPQAAS APQLSRGEDT FSVAVNNQRW AFSRQQGVLT QYWIDDQPQL       780
     LSPLRDQFTR APLDNDIGVS EVTRIDPNAW VERWKAAGHY QSEVTTLQCT AEALSDAVVI       840
     NTVHAWQFQG KTLFISRKAY RIDGFGEMAV TVNVEIASGT PYPARIGMSC QLTQIVERVN       900
     WLGLGPHENY PDRLTSACFD RWGLPLSEMY TPYVFPTENG LRCGTRELNY GAHQWRGDFQ       960
     FNISRYSQTQ LMETCHRHLL RPEAGTWLNI DGFHMGVGGD DSWSPSVSPE FLLSAGRYSY      1020
     QFIWGQQK                                                               1028
//

If you have problems or comments...

PBIL Back to PBIL home page