(data stored in SCRATCH zone)

EMBL: CP001875.NUSG

CP001875.NUSG        Location/Qualifiers
FT   CDS             247065..247610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="PANA_0210"
FT                   /product="NusG"
FT                   /note="Transcription antitermination protein NusG; Similar
FT                   to Erwinia tasmaniensis Et1/99, transcription
FT                   antitermination protein NusG (NCBI: YP_001906106.1); COG:
FT                   Transcription; Subcellular localization as predicted by
FT                   Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75377"
FT                   /db_xref="GOA:D4GH62"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D4GH62"
FT                   /protein_id="ADD75377.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGDVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEDVDYEKSRLTVSVS
FT                   IFGRATPVELDFGQVEKG"
     MSEAPKKRWY VVQAFSGFEG RVAQSLREHI KLHNMEELFG DVMVPTEEVV EIRGGQRRKS        60
     ERKFFPGYVL VQMVMNDASW HLVRSVPRVM GFIGGTSDRP APISDKEVDA IMNRLQQVGD       120
     KPRPKTLFEP GEMVRVNDGP FADFNGVVED VDYEKSRLTV SVSIFGRATP VELDFGQVEK       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page