(data stored in SCRATCH zone)

EMBL: CP001875.PE300

CP001875.PE300       Location/Qualifiers
FT   CDS             364295..365020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0300"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Pantoea sp. At-9b, Gluconate
FT                   2-dehydrogenase (acceptor) (NCBI: ZP_05732064.1); COG:
FT                   Carbohydrate transport and metabolism; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75467"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHF2"
FT                   /protein_id="ADD75467.1"
FT                   /translation="MSDQKKGHSRRDFLLKTITLAPAVAVGSSALGAFSAPVQAAAPAA
FT                   PQSARDYQPTWFTAEEFAFIKAAVARLIPADERGPGALEAGVPEFIDRQMNTPYATGAN
FT                   WYMQGPFNPDVPKEMGYQLPLVPQQIYRLGLADADHYSQQQHGKVFAQLDAGQQDALLQ
FT                   DMESGKAGFRQLPANVFFSYLLQNTREGFFSDPIHGGNQGMVGWKLINFPGARADFMDW
FT                   VERGERYPFPSVSIRGERS"
     MSDQKKGHSR RDFLLKTITL APAVAVGSSA LGAFSAPVQA AAPAAPQSAR DYQPTWFTAE        60
     EFAFIKAAVA RLIPADERGP GALEAGVPEF IDRQMNTPYA TGANWYMQGP FNPDVPKEMG       120
     YQLPLVPQQI YRLGLADADH YSQQQHGKVF AQLDAGQQDA LLQDMESGKA GFRQLPANVF       180
     FSYLLQNTRE GFFSDPIHGG NQGMVGWKLI NFPGARADFM DWVERGERYP FPSVSIRGER       240
     S                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page