(data stored in SCRATCH zone)

EMBL: CP001875.PE369

CP001875.PE369       Location/Qualifiers
FT   CDS             complement(441013..442539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="PANA_0369"
FT                   /product="RbsA"
FT                   /note="Ribose transport ATP-binding protein RbsA; Similar
FT                   to Pantoea sp. At-9b, ABC transporter related protein
FT                   (NCBI: ZP_05728074.1); COG: Carbohydrate transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75536"
FT                   /db_xref="GOA:D4GI06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI06"
FT                   /protein_id="ADD75536.1"
FT                   /translation="MQPHPDKPVLTLSHITKRFGGNPAVNDVSLDVFPGEVVALLGENG
FT                   AGKSTLIKVLAGVYTSDEGQITFQGNVTASAAALKTATSQPIAFIHQDLGLIEWMTVAE
FT                   NMALVMGFNRRFGLVNWRAVRERARSALEEVGIQLDPDARVFELSRTEKSLLAIARAVA
FT                   VNAEVLVLDEPTASLPANDVRHLFGVIERLKSRNVGMIYVTHRLDEVIEIADRICVMRD
FT                   GKRVAEGVTADYKLHDLVEMIVGEALESNQRLALPEARPPVLSLNQLCIDEVGPVSFSL
FT                   QPGEMLALAGLRGAGQEEIGRMLFGLKQATSGQVIFRDNPCHPRSPREAMAAGISLVAG
FT                   DRTGESLVMSMSVRENLFINPCASGHRLISHYGRRAEVGASWWKVQLFDVRPKDVNLDI
FT                   SALSGGNQQKVVMARWMHLNAPLLILEDPTAGVDVGAREEIYHLLNKALAEGVAVLVIS
FT                   NDLEEIAHICNRALVFNRGQVVGELRNEQVTFAGLLELASASSAAPLATV"
     MQPHPDKPVL TLSHITKRFG GNPAVNDVSL DVFPGEVVAL LGENGAGKST LIKVLAGVYT        60
     SDEGQITFQG NVTASAAALK TATSQPIAFI HQDLGLIEWM TVAENMALVM GFNRRFGLVN       120
     WRAVRERARS ALEEVGIQLD PDARVFELSR TEKSLLAIAR AVAVNAEVLV LDEPTASLPA       180
     NDVRHLFGVI ERLKSRNVGM IYVTHRLDEV IEIADRICVM RDGKRVAEGV TADYKLHDLV       240
     EMIVGEALES NQRLALPEAR PPVLSLNQLC IDEVGPVSFS LQPGEMLALA GLRGAGQEEI       300
     GRMLFGLKQA TSGQVIFRDN PCHPRSPREA MAAGISLVAG DRTGESLVMS MSVRENLFIN       360
     PCASGHRLIS HYGRRAEVGA SWWKVQLFDV RPKDVNLDIS ALSGGNQQKV VMARWMHLNA       420
     PLLILEDPTA GVDVGAREEI YHLLNKALAE GVAVLVISND LEEIAHICNR ALVFNRGQVV       480
     GELRNEQVTF AGLLELASAS SAAPLATV                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page