(data stored in SCRATCH zone)

EMBL: CP001875.PE393

CP001875.PE393       Location/Qualifiers
FT   CDS             complement(466352..466480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0393"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Yersinia pestis biovar Orientalis str.
FT                   IP275, hypothetical protein YPIP275_3285 (NCBI:
FT                   ZP_02225082.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75560"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI30"
FT                   /protein_id="ADD75560.1"
FT                   /translation="MTEIQAISHVLRGFFIKAVDGLRPLRFNAPRCPNSSVGRAGD"
     MTEIQAISHV LRGFFIKAVD GLRPLRFNAP RCPNSSVGRA GD                           42
//

If you have problems or comments...

PBIL Back to PBIL home page