(data stored in SCRATCH zone)

EMBL: CP001875.PE45

CP001875.PE45        Location/Qualifiers
FT   CDS             48837..49946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0045"
FT                   /product="Hypothetical Protein"
FT                   /note="Predicted Cytoplasmic Protein; Similar to
FT                   Rhodospirillum rubrum ATCC 11170, hypothetical protein
FT                   Rru_A2298 (NCBI: YP_427385.1); COG: Unknown Function;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75212"
FT                   /db_xref="GOA:D4GFU8"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFU8"
FT                   /protein_id="ADD75212.1"
FT                   /translation="MRPVMQHTLLPTTFLLQKAFFRTQPVEVVKAAGCSATLFTYESGI
FT                   EAVRLKNARGHLVVLPYFGQMIWQAMFDGVDLTMQSRFTEPRPASDIVGTYGCFMYHSG
FT                   LLRNGNPTAEDTHALHGEMPVAPMQRARIETGEDAQGPWLALVSEREYLMGFGDHYLAQ
FT                   PRVVIRPDSATFEVCMEVENLSRNPMDLMYMCHANFAYVEGARIIQPAAFTAADTVIRS
FT                   SVPAIVKANDAYLARLEQLRHDPASTEVLSAELQPDPELVFYIKNLRKAEDGQVHVMLR
FT                   RPEGDAFTVNYNPEHFPFLTRWILANNMQKVCAFAMPATCGVEGYLAEKRAGNVRSLAG
FT                   GERACFSMTLGYLNAQESQHEEAQIHDSV"
     MRPVMQHTLL PTTFLLQKAF FRTQPVEVVK AAGCSATLFT YESGIEAVRL KNARGHLVVL        60
     PYFGQMIWQA MFDGVDLTMQ SRFTEPRPAS DIVGTYGCFM YHSGLLRNGN PTAEDTHALH       120
     GEMPVAPMQR ARIETGEDAQ GPWLALVSER EYLMGFGDHY LAQPRVVIRP DSATFEVCME       180
     VENLSRNPMD LMYMCHANFA YVEGARIIQP AAFTAADTVI RSSVPAIVKA NDAYLARLEQ       240
     LRHDPASTEV LSAELQPDPE LVFYIKNLRK AEDGQVHVML RRPEGDAFTV NYNPEHFPFL       300
     TRWILANNMQ KVCAFAMPAT CGVEGYLAEK RAGNVRSLAG GERACFSMTL GYLNAQESQH       360
     EEAQIHDSV                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page