(data stored in SCRATCH zone)

EMBL: CP001875.PE504

CP001875.PE504       Location/Qualifiers
FT   CDS             complement(586920..587675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0504"
FT                   /product="Hypothetical Protein"
FT                   /note="Cytoplasmic Protein; Similar to Klebsiella
FT                   pneumoniae 342, hypothetical protein KPK_2646 (NCBI:
FT                   YP_002238476.1); COG: Amino acid transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75671"
FT                   /db_xref="InterPro:IPR010768"
FT                   /db_xref="InterPro:IPR017027"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIS6"
FT                   /protein_id="ADD75671.1"
FT                   /translation="MQKKILLVGESWTSTSVHVKGFDQFATATWHNGATDFMAALADSD
FT                   YAITYMPAHAAATEFPLTLAGLQAWDAIILSDIGANTLLLHPDTWLKSQRTANRLTLIH
FT                   DYVAAGGALMMIGGYFSFQGINGGARYRNTAVEKVLPVRCLAWDDRIETPEGSYPSVTE
FT                   SHTLFTDMPDEWPWLLGYNEVEMHPEGKLLATIAGTAHPLLAVREYQQGRSLVWTSDMS
FT                   AHWLPQEFAQWQGYRQLWINCLDWLTVRH"
     MQKKILLVGE SWTSTSVHVK GFDQFATATW HNGATDFMAA LADSDYAITY MPAHAAATEF        60
     PLTLAGLQAW DAIILSDIGA NTLLLHPDTW LKSQRTANRL TLIHDYVAAG GALMMIGGYF       120
     SFQGINGGAR YRNTAVEKVL PVRCLAWDDR IETPEGSYPS VTESHTLFTD MPDEWPWLLG       180
     YNEVEMHPEG KLLATIAGTA HPLLAVREYQ QGRSLVWTSD MSAHWLPQEF AQWQGYRQLW       240
     INCLDWLTVR H                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page