(data stored in SCRATCH zone)

EMBL: CP001875.PE506

CP001875.PE506       Location/Qualifiers
FT   CDS             complement(588771..589823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="PANA_0506"
FT                   /product="RbsC"
FT                   /note="Ribose transport system permease protein RbsC;
FT                   Similar to Pantoea sp. At-9b, Monosaccharide-transporting
FT                   ATPase (NCBI: ZP_05729856.1); COG: Carbohydrate transport
FT                   and metabolism; Subcellular localization as predicted by
FT                   Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75673"
FT                   /db_xref="GOA:D4GIS8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIS8"
FT                   /protein_id="ADD75673.1"
FT                   /translation="MSPALRRRTERGNRMTIMNLSGSRMAQHSLPRRLLHNHSGVVSIA
FT                   LFFVFCCVVFSLITGNFLSSANWLNIIRQSAPLLIVATAMTLVITTGGIDLSVGSTLAL
FT                   VGALSAIALNNWGLPWPVVLLGGLLLGALVGAINGFFIAYEGIPAFIVTLATLAVVRGV
FT                   ALLITQGYSIPIPADSLFAFMGRAKVLGVPMPALIGIVVLIVGHIVLNHMRFGRYVTAI
FT                   GANAEGARRSGINTKAVTMKVYIISGMAAALAGMIITARLGSGSSNQGEGFELQVIAAV
FT                   VLGSTSLFGGFGTIIGTLLGALSIAIIQNGLILSHISPFYTQIATGTIILLAIWLNTRI
FT                   LNPTRAAAKG"
     MSPALRRRTE RGNRMTIMNL SGSRMAQHSL PRRLLHNHSG VVSIALFFVF CCVVFSLITG        60
     NFLSSANWLN IIRQSAPLLI VATAMTLVIT TGGIDLSVGS TLALVGALSA IALNNWGLPW       120
     PVVLLGGLLL GALVGAINGF FIAYEGIPAF IVTLATLAVV RGVALLITQG YSIPIPADSL       180
     FAFMGRAKVL GVPMPALIGI VVLIVGHIVL NHMRFGRYVT AIGANAEGAR RSGINTKAVT       240
     MKVYIISGMA AALAGMIITA RLGSGSSNQG EGFELQVIAA VVLGSTSLFG GFGTIIGTLL       300
     GALSIAIIQN GLILSHISPF YTQIATGTII LLAIWLNTRI LNPTRAAAKG                  350
//

If you have problems or comments...

PBIL Back to PBIL home page