(data stored in SCRATCH zone)

EMBL: CP001875.PE509

CP001875.PE509       Location/Qualifiers
FT   CDS             592217..593215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="PANA_0509"
FT                   /product="RbsB"
FT                   /note="D-ribose-binding periplasmic protein precursor;
FT                   Similar to Klebsiella pneumoniae NTUH-K2044, putative ABC
FT                   transport system nucleotide binding/ATPase component (NCBI:
FT                   YP_002919499.1); COG: Carbohydrate transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75676"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIT1"
FT                   /protein_id="ADD75676.1"
FT                   /translation="MRRSTGYRTFPTRNFKMMAFNTRKLRSVALATGLLAAGSFFTLAH
FT                   AAPTYALVQINQQALFFNQMNQGAQEAAKASGKNLVIFNANDNPVSQNDAIENYIQQGV
FT                   KGIMVDAIDVNGIMPAIKEAAAAKIPVIAIDAVLPAGPQAAQVGVDNLEGGKIIGKYFV
FT                   DYVAKNMGGKARLGIVGALNSAVQNQRQKGFEDTIKSNPGITVADVVDGQNVQDTAMTA
FT                   AENLITGNPDLTAIYATGEPALLGAIAAVENQGRQKDIKVFGWDLTSKAITGIDNGYVT
FT                   AVLQQDPKKMGEEAVKALNAVTSGKTVSKTILVPATVVTKANVDSYRAMFK"
     MRRSTGYRTF PTRNFKMMAF NTRKLRSVAL ATGLLAAGSF FTLAHAAPTY ALVQINQQAL        60
     FFNQMNQGAQ EAAKASGKNL VIFNANDNPV SQNDAIENYI QQGVKGIMVD AIDVNGIMPA       120
     IKEAAAAKIP VIAIDAVLPA GPQAAQVGVD NLEGGKIIGK YFVDYVAKNM GGKARLGIVG       180
     ALNSAVQNQR QKGFEDTIKS NPGITVADVV DGQNVQDTAM TAAENLITGN PDLTAIYATG       240
     EPALLGAIAA VENQGRQKDI KVFGWDLTSK AITGIDNGYV TAVLQQDPKK MGEEAVKALN       300
     AVTSGKTVSK TILVPATVVT KANVDSYRAM FK                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page