(data stored in SCRATCH zone)

EMBL: CP001875.PE51

CP001875.PE51        Location/Qualifiers
FT   CDS             complement(56471..57688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0051"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Serratia proteamaculans,AF487831_1 Qsc4
FT                   (NCBI: AAO49467.1); COG: Carbohydrate transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75218"
FT                   /db_xref="GOA:D4GFV4"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFV4"
FT                   /protein_id="ADD75218.1"
FT                   /translation="MTMFPVLLSALTSGVSMAVFFTAIAWFIESTFGSSLLVSTVLSSG
FT                   YIITFFALPFIGHITDKTTCKRMLTIMYVLGAINALAFFLINPGELSALLSFTVILLST
FT                   SVFTLIRASDQVIRATYMKKVLPEQKLYHANRLLEMVRQGITFLSGGVAFFILQDKSIH
FT                   NVCLVMLLCFTLSLLINVFIPVDNVSGAEPESHKTLKGGMYVKGYDFFLGEQKRVVELL
FT                   SLFPYICVVFLNALYPALFTQIGAPVSAYAILVVPYGLGAIAGSMLNSQRYLPTLKSVY
FT                   LLFGTVFTLGLLLPLLFKTLSAVYACLFLIAFCHCHIRVRRNTLIMTQSDSQALARILS
FT                   FNEIVFICLSTLLGLGLSFMADRLGFWLAWESVIGLNIVVLMLITAVRRVPTSTIAVSN
FT                   ATENGR"
     MTMFPVLLSA LTSGVSMAVF FTAIAWFIES TFGSSLLVST VLSSGYIITF FALPFIGHIT        60
     DKTTCKRMLT IMYVLGAINA LAFFLINPGE LSALLSFTVI LLSTSVFTLI RASDQVIRAT       120
     YMKKVLPEQK LYHANRLLEM VRQGITFLSG GVAFFILQDK SIHNVCLVML LCFTLSLLIN       180
     VFIPVDNVSG AEPESHKTLK GGMYVKGYDF FLGEQKRVVE LLSLFPYICV VFLNALYPAL       240
     FTQIGAPVSA YAILVVPYGL GAIAGSMLNS QRYLPTLKSV YLLFGTVFTL GLLLPLLFKT       300
     LSAVYACLFL IAFCHCHIRV RRNTLIMTQS DSQALARILS FNEIVFICLS TLLGLGLSFM       360
     ADRLGFWLAW ESVIGLNIVV LMLITAVRRV PTSTIAVSNA TENGR                       405
//

If you have problems or comments...

PBIL Back to PBIL home page