(data stored in SCRATCH zone)

EMBL: CP001875.PE519

CP001875.PE519       Location/Qualifiers
FT   CDS             603256..604218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PANA_0519"
FT                   /product="Hypothetical Protein"
FT                   /note="Similar to Yersinia bercovieri ATCC 43970,
FT                   hypothetical protein yberc0001_9280 (NCBI: ZP_04629028.1);
FT                   COG: Unknown Function; Subcellular localization as
FT                   predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75686"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIU1"
FT                   /protein_id="ADD75686.1"
FT                   /translation="MAAIMTDLDNIELHFSGHETFPLRNMWLKRVYDQADIHGLVDKSI
FT                   FADESAIVRFGVGKNMVSSMKHWAIATGMLQEYKDSKYFELSMLAKLLFSDNGLDPYSE
FT                   NIATTWLLHWQLAGLFGSGAAHRTKSTTWVLLFNLFIATDFSNKDLLNIIRGFVSKNSN
FT                   KNVSENTLKRDVEVCLKSYTVLMDKPKFDDVSEPVLAELGLIRPTLPGRFGFVRGKQET
FT                   LPDGIFDYCLITFWLSNENYQNAISLNDICHAKGSPGLIFKMDEDAVAERLFNIAERTQ
FT                   GKINWVNTSGMYQVIRKMGKKENTFFELAIDRLKSSYNA"
     MAAIMTDLDN IELHFSGHET FPLRNMWLKR VYDQADIHGL VDKSIFADES AIVRFGVGKN        60
     MVSSMKHWAI ATGMLQEYKD SKYFELSMLA KLLFSDNGLD PYSENIATTW LLHWQLAGLF       120
     GSGAAHRTKS TTWVLLFNLF IATDFSNKDL LNIIRGFVSK NSNKNVSENT LKRDVEVCLK       180
     SYTVLMDKPK FDDVSEPVLA ELGLIRPTLP GRFGFVRGKQ ETLPDGIFDY CLITFWLSNE       240
     NYQNAISLND ICHAKGSPGL IFKMDEDAVA ERLFNIAERT QGKINWVNTS GMYQVIRKMG       300
     KKENTFFELA IDRLKSSYNA                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page