(data stored in SCRATCH zone)

EMBL: CP001875.PHOU

CP001875.PHOU        Location/Qualifiers
FT   CDS             37208..37942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="PANA_0036"
FT                   /product="PhoU"
FT                   /note="Phosphate transport system protein PhoU; Similar to
FT                   Pantoea sp. At-9b, phosphate uptake regulator, PhoU (NCBI:
FT                   ZP_05729623.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75203"
FT                   /db_xref="GOA:D4GFT9"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT9"
FT                   /protein_id="ADD75203.1"
FT                   /translation="MDSLNLNKHISGQFNAELEHIRTQVMIMGGLVEQQLTDAITAMHN
FT                   LDGELAQRVIDGDQKVNMMEVEIDEACVRIIAKRQPTAIDLRLVMAIIKTISELERIGD
FT                   VAEKISRTALEKFGQQHLPLLVSLESLGRHTVQMLHDVLDAFARMDLNEAVQIYREDKK
FT                   VDKEYEGIVRQLMTYMMEDPRTIPSVLTALFCARAIERIGDRCQNICEIIFYFVKGQDF
FT                   RHVGGDKLDELLSGDDGSNKPS"
     MDSLNLNKHI SGQFNAELEH IRTQVMIMGG LVEQQLTDAI TAMHNLDGEL AQRVIDGDQK        60
     VNMMEVEIDE ACVRIIAKRQ PTAIDLRLVM AIIKTISELE RIGDVAEKIS RTALEKFGQQ       120
     HLPLLVSLES LGRHTVQMLH DVLDAFARMD LNEAVQIYRE DKKVDKEYEG IVRQLMTYMM       180
     EDPRTIPSVL TALFCARAIE RIGDRCQNIC EIIFYFVKGQ DFRHVGGDKL DELLSGDDGS       240
     NKPS                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page