(data stored in SCRATCH zone)

EMBL: CP001875.PSTB

CP001875.PSTB        Location/Qualifiers
FT   CDS             36417..37190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="PANA_0035"
FT                   /product="PstB"
FT                   /note="Phosphate import ATP-binding protein PstB; Similar
FT                   to Pantoea sp. At-9b, phosphate ABC transporter, ATPase
FT                   subunit (NCBI: ZP_05729622.1); COG: Inorganic ion transport
FT                   and metabolism; Subcellular localization as predicted by
FT                   Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75202"
FT                   /db_xref="GOA:D4GFT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT8"
FT                   /protein_id="ADD75202.1"
FT                   /translation="MSTATASAGKIEVRNLNFYYGKFHALKNINLDIAKNQVTAFIGPS
FT                   GCGKSTLLRTFNKMYSLYPDQRAEGDILLDGDNILASHQDIALLRARVGMVFQKPTPFP
FT                   MSIYDNIAFGVRLFEKLSRADMDERVQWALTKAALWNETKDKLHQSGYSLSGGQQQRLC
FT                   IARGIAIRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARCSDHT
FT                   AFMYLGELIEFSDTDTLFTKPAQKQTEDYITGRYG"
     MSTATASAGK IEVRNLNFYY GKFHALKNIN LDIAKNQVTA FIGPSGCGKS TLLRTFNKMY        60
     SLYPDQRAEG DILLDGDNIL ASHQDIALLR ARVGMVFQKP TPFPMSIYDN IAFGVRLFEK       120
     LSRADMDERV QWALTKAALW NETKDKLHQS GYSLSGGQQQ RLCIARGIAI RPEVLLLDEP       180
     CSALDPISTG RIEELITELK QDYTVVIVTH NMQQAARCSD HTAFMYLGEL IEFSDTDTLF       240
     TKPAQKQTED YITGRYG                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page