(data stored in SCRATCH zone)

EMBL: CP001875.PSTS

CP001875.PSTS        Location/Qualifiers
FT   CDS             33393..34436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="PANA_0032"
FT                   /product="PstS"
FT                   /note="Phosphate-binding periplasmic protein precursor;
FT                   Similar to Pantoea sp. At-9b, phosphate ABC transporter,
FT                   periplasmic phosphate-binding protein (NCBI:
FT                   ZP_05729619.1); COG: Inorganic ion transport and
FT                   metabolism; Subcellular localization as predicted by Psort
FT                   2.0: Periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75199"
FT                   /db_xref="GOA:D4GFT5"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFT5"
FT                   /protein_id="ADD75199.1"
FT                   /translation="MTLMRSTVARILAASLAVSAVSAFAATDLTGAGGTFPAPVYAKWA
FT                   AEYQQATGSKINYQGIGSSGGVKQIIAKTVDFGASDAPMKDEDLQKNGLFQFPTVIGGV
FT                   VLAVNLPGVKSGQLTLDGKTVGDIYLGNIKKWNDPAIVKLNPGVKLPDTNINVVRRADG
FT                   SGTSFVFTSYLAKVNEEWNSKIGKGNTVNWPTGLGGKGNDGVAAFVQRLPGSIGYVEYA
FT                   YAKQNNLTYTKLMDADGKAVAPSEISFSNAAKGADWSKSFAQDLTFQKGNDAWPITSTT
FT                   FILIYKDQANAAKGAEVLKFFDWAYKNGGKTANALDYATLPESVVQQIRAAWKANIKDS
FT                   SGKALYK"
     MTLMRSTVAR ILAASLAVSA VSAFAATDLT GAGGTFPAPV YAKWAAEYQQ ATGSKINYQG        60
     IGSSGGVKQI IAKTVDFGAS DAPMKDEDLQ KNGLFQFPTV IGGVVLAVNL PGVKSGQLTL       120
     DGKTVGDIYL GNIKKWNDPA IVKLNPGVKL PDTNINVVRR ADGSGTSFVF TSYLAKVNEE       180
     WNSKIGKGNT VNWPTGLGGK GNDGVAAFVQ RLPGSIGYVE YAYAKQNNLT YTKLMDADGK       240
     AVAPSEISFS NAAKGADWSK SFAQDLTFQK GNDAWPITST TFILIYKDQA NAAKGAEVLK       300
     FFDWAYKNGG KTANALDYAT LPESVVQQIR AAWKANIKDS SGKALYK                     347
//

If you have problems or comments...

PBIL Back to PBIL home page