(data stored in SCRATCH zone)

EMBL: CP001875.PYRB

CP001875.PYRB        Location/Qualifiers
FT   CDS             complement(570476..571411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="PANA_0488"
FT                   /product="PyrB"
FT                   /note="Aspartate carbamoyltransferase catalytic chain;
FT                   Similar to Pantoea agglomerans,AF190426_2 aspartate
FT                   transcarbamylase catalytic subunit (NCBI: AAF01338.1); COG:
FT                   Nucleotide transport and metabolism; Subcellular
FT                   localization as predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75655"
FT                   /db_xref="GOA:D4GIR0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIR0"
FT                   /protein_id="ADD75655.1"
FT                   /translation="MANPLYRKHIISINDLSRDELELVLHTAAQLKAHPQPELLKHNVI
FT                   ASCFFEASTRTRLSFETAIHRLGASAVGFADGSNTSLGKKGETLADTISVISTYVDAIV
FT                   MRHPQEGAARLATEFSNGIPILNAGDGANQHPTQTLLDLFTIRETQGRLSNLNVAMVGD
FT                   LKYGRTVHSLTQALAKFDGNRFFFIAPDALAMPAYITDMLDEQNITWSRHDSFEEVMPD
FT                   LDILYMTRVQKERLDPSEYANVKAQFILRAADLNGARDNMKVLHPLPRIDEITTDVDST
FT                   PYAWYFQQAGNGIYARQALLALVLNSDTAL"
     MANPLYRKHI ISINDLSRDE LELVLHTAAQ LKAHPQPELL KHNVIASCFF EASTRTRLSF        60
     ETAIHRLGAS AVGFADGSNT SLGKKGETLA DTISVISTYV DAIVMRHPQE GAARLATEFS       120
     NGIPILNAGD GANQHPTQTL LDLFTIRETQ GRLSNLNVAM VGDLKYGRTV HSLTQALAKF       180
     DGNRFFFIAP DALAMPAYIT DMLDEQNITW SRHDSFEEVM PDLDILYMTR VQKERLDPSE       240
     YANVKAQFIL RAADLNGARD NMKVLHPLPR IDEITTDVDS TPYAWYFQQA GNGIYARQAL       300
     LALVLNSDTA L                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page