(data stored in SCRATCH zone)

EMBL: CP001875.RARD

CP001875.RARD        Location/Qualifiers
FT   CDS             complement(199151..200050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="PANA_0172"
FT                   /product="RarD"
FT                   /note="Protein RarD; Similar to Pantoea sp. At-9b, RarD
FT                   protein, DMT superfamily transporter (NCBI: ZP_05730685.1);
FT                   COG: General function prediction only; Subcellular
FT                   localization as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75339"
FT                   /db_xref="GOA:D4GGN8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGN8"
FT                   /protein_id="ADD75339.1"
FT                   /translation="MDTQQTRQGIGFALGAYFIWGIAPAYFKLVKAVPATEIMTHRVIW
FT                   SALFMLLLITLSRSWGQVRSVLRQPKKVLLLALTAVTVGGNWLLFIWAVNNQHMLEASL
FT                   GYFINPLINVVFGMIFLRERFRRLQWLAVALAAGGVLLQLWKFGSVPVIALGLAFSFAF
FT                   YGLMRKKIQVDAQSGMLIETLWLFPLAALYLFGFADSRTSHLSANPMSLNLLLIAAGIV
FT                   TTIPLMFFAAACTRLRLSTVGFFQYLGPTLMFLLAVLFYGETVTPDKMVTFGFIWLALL
FT                   VFILDAVTFSARSRMRKA"
     MDTQQTRQGI GFALGAYFIW GIAPAYFKLV KAVPATEIMT HRVIWSALFM LLLITLSRSW        60
     GQVRSVLRQP KKVLLLALTA VTVGGNWLLF IWAVNNQHML EASLGYFINP LINVVFGMIF       120
     LRERFRRLQW LAVALAAGGV LLQLWKFGSV PVIALGLAFS FAFYGLMRKK IQVDAQSGML       180
     IETLWLFPLA ALYLFGFADS RTSHLSANPM SLNLLLIAAG IVTTIPLMFF AAACTRLRLS       240
     TVGFFQYLGP TLMFLLAVLF YGETVTPDKM VTFGFIWLAL LVFILDAVTF SARSRMRKA        299
//

If you have problems or comments...

PBIL Back to PBIL home page