(data stored in SCRATCH zone)

EMBL: CP001875.RBSD

CP001875.RBSD        Location/Qualifiers
FT   CDS             complement(6973..7392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="PANA_0008"
FT                   /product="RbsD"
FT                   /note="High affinity ribose transport protein RbsD; Similar
FT                   to Pantoea sp. At-9b, RbsD or FucU transport (NCBI:
FT                   ZP_05729595.1); COG: Carbohydrate transport and metabolism;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75175"
FT                   /db_xref="GOA:D4GFR1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFR1"
FT                   /protein_id="ADD75175.1"
FT                   /translation="MKKGRLLNAELSYVIARLGHTDTLTIADAGLPIPAETQRIDLALI
FT                   PGTPGFMQVVEAVTHEMQVESAFIAEEIKQHNPQLHSELIAVLDALQQHQGNTISIHYI
FT                   SHEQFKQQTQRSQAVVRSGECSPFANVILSAGVTF"
     MKKGRLLNAE LSYVIARLGH TDTLTIADAG LPIPAETQRI DLALIPGTPG FMQVVEAVTH        60
     EMQVESAFIA EEIKQHNPQL HSELIAVLDA LQQHQGNTIS IHYISHEQFK QQTQRSQAVV       120
     RSGECSPFAN VILSAGVTF                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page