(data stored in SCRATCH zone)

EMBL: CP001875.RNPA

CP001875.RNPA        Location/Qualifiers
FT   CDS             98297..98656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="PANA_0092"
FT                   /product="RnpA"
FT                   /note="Ribonuclease P protein component; Similar to
FT                   Citrobacter sp. 30_2, ribonuclease P protein component
FT                   (NCBI: ZP_04559507.1); COG: General function prediction
FT                   only; Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75259"
FT                   /db_xref="GOA:D4GGF8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGF8"
FT                   /protein_id="ADD75259.1"
FT                   /translation="MGKLAFPRELRLLTPTHFTFVFQQPQRAGTPQITILGRLNALGYP
FT                   RIGLTVAKKHVKRAHERNRIKRLTRESFRLRQHELPSMDFVVVAKKGVADLDNRMLAEA
FT                   LEKLWRRHCRLARGS"
     MGKLAFPREL RLLTPTHFTF VFQQPQRAGT PQITILGRLN ALGYPRIGLT VAKKHVKRAH        60
     ERNRIKRLTR ESFRLRQHEL PSMDFVVVAK KGVADLDNRM LAEALEKLWR RHCRLARGS        119
//

If you have problems or comments...

PBIL Back to PBIL home page