(data stored in SCRATCH zone)

EMBL: CP001875.TAR

CP001875.TAR         Location/Qualifiers
FT   CDS             complement(369867..371348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tar"
FT                   /locus_tag="PANA_0304"
FT                   /product="Tar"
FT                   /note="Methyl-accepting chemotaxis protein II; Similar to
FT                   Oryza sativa Indica Group, hypothetical protein OsI_25978
FT                   (NCBI: EEC82019.1); COG: Cell motility and chemotaxis;
FT                   Subcellular localization as predicted by Psort 2.0: Inner
FT                   Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75471"
FT                   /db_xref="GOA:D4GHF6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:D4GHF6"
FT                   /protein_id="ADD75471.1"
FT                   /translation="MLSVIDPINHSRTLRVRLMEYMKEIENDGPQGGYSLDSVKSVAAK
FT                   ADAAFQAYLSAPRIPGEEADADRYRQAYLAYRDQGIQPLIEAAEARDQQRFKNQIANVV
FT                   RLDRQYEIVLDQVLAQHEAYAKKLNTDAQGNFSSGITLLIVFGLLFLAIIIAILIFVRR
FT                   YILSPLNNAKAHCSEIAAGVLDHPVPVKIGSKSEIQQLMSSMEQMRTSLTDIIIRVRHS
FT                   THAVSCASQEIASGNIDLASRTEQQAAALTETAASMEQLGATVKQNTDNVFEACRLANE
FT                   AVQNAETGEKVSQQVIVSMAKINESSKKIEDITSVINSIAFQTNILALNAAVEAARAGE
FT                   QGRGFAVVAGEVRNLAQRSAVAAKEIEGLIAESVATIRVGSDQVSRTGEAMNAIISSVS
FT                   RVNELMDHISTASDEQHHGISQIEKAVTEMDGVTQQKRRAGPGVGRRGCFAGRAGSAPD
FT                   PLRFCFPPVWRLKRIPARVIRPERETDSVRRGVSL"
     MLSVIDPINH SRTLRVRLME YMKEIENDGP QGGYSLDSVK SVAAKADAAF QAYLSAPRIP        60
     GEEADADRYR QAYLAYRDQG IQPLIEAAEA RDQQRFKNQI ANVVRLDRQY EIVLDQVLAQ       120
     HEAYAKKLNT DAQGNFSSGI TLLIVFGLLF LAIIIAILIF VRRYILSPLN NAKAHCSEIA       180
     AGVLDHPVPV KIGSKSEIQQ LMSSMEQMRT SLTDIIIRVR HSTHAVSCAS QEIASGNIDL       240
     ASRTEQQAAA LTETAASMEQ LGATVKQNTD NVFEACRLAN EAVQNAETGE KVSQQVIVSM       300
     AKINESSKKI EDITSVINSI AFQTNILALN AAVEAARAGE QGRGFAVVAG EVRNLAQRSA       360
     VAAKEIEGLI AESVATIRVG SDQVSRTGEA MNAIISSVSR VNELMDHIST ASDEQHHGIS       420
     QIEKAVTEMD GVTQQKRRAG PGVGRRGCFA GRAGSAPDPL RFCFPPVWRL KRIPARVIRP       480
     ERETDSVRRG VSL                                                          493
//

If you have problems or comments...

PBIL Back to PBIL home page