(data stored in SCRATCH zone)

EMBL: CP001875.TATC

CP001875.TATC        Location/Qualifiers
FT   CDS             222333..223091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="PANA_0195"
FT                   /product="TatC"
FT                   /note="Sec-independent protein translocase protein TatC;
FT                   Similar to Pantoea sp. At-9b, Sec-independent protein
FT                   translocase, TatC subunit (NCBI: ZP_05730707.1); COG:
FT                   Intracellular trafficking, secretion, and vesicular
FT                   transport; Subcellular localization as predicted by Psort
FT                   2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75362"
FT                   /db_xref="GOA:D4GGR1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGR1"
FT                   /protein_id="ADD75362.1"
FT                   /translation="MAVEDTQPLISHLIELRKRLLNCIVAVLVIFLALIYFANDIYHAV
FT                   ASPLINQMPAGASMIATDVASPFFTPIKLTMIVSVFLAVPVILYQVWAFVAPALYRHER
FT                   KLVMPLLFSSTLLFYVGVAFAYFIVFPLAFGFFAKTAPQGVTIATDITNYLDFVMTLFM
FT                   AFGVAFEVPVAIVLLCWTGITNPDDLKKKRPYILVGAFVVGMLLTPPDVFSQTLLAIPM
FT                   YCLFEVGVFFSRYYVGKGRQAEDEEHNADS"
     MAVEDTQPLI SHLIELRKRL LNCIVAVLVI FLALIYFAND IYHAVASPLI NQMPAGASMI        60
     ATDVASPFFT PIKLTMIVSV FLAVPVILYQ VWAFVAPALY RHERKLVMPL LFSSTLLFYV       120
     GVAFAYFIVF PLAFGFFAKT APQGVTIATD ITNYLDFVMT LFMAFGVAFE VPVAIVLLCW       180
     TGITNPDDLK KKRPYILVGA FVVGMLLTPP DVFSQTLLAI PMYCLFEVGV FFSRYYVGKG       240
     RQAEDEEHNA DS                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page