(data stored in SCRATCH zone)

EMBL: CP001875.TNAA

CP001875.TNAA        Location/Qualifiers
FT   CDS             complement(125590..127014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnaA"
FT                   /locus_tag="PANA_0116"
FT                   /product="TnaA"
FT                   /note="Tryptophanase; Similar to Escherichia coli O157:H7
FT                   EDL933, tryptophanase (NCBI: NP_290344.1); COG: Amino acid
FT                   transport and metabolism; Subcellular localization as
FT                   predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75283"
FT                   /db_xref="GOA:D4GGI2"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013440"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018176"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGI2"
FT                   /protein_id="ADD75283.1"
FT                   /translation="MMMNNFRHLPEPFRIRVIEPVKRTTREHRDAAMIKAGMNPFLLNS
FT                   EDVFIDLLTDSGTGAVTQNMQAAMMRGDESYSGSRSYYALAEAVKAIFGYAYTIPTHQG
FT                   RGAEQIYIPVLIKKREQEKGLDRTKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDT
FT                   AVRHDFKGDFDLERLEKGIQDVGAENVPYIVATITCNSAGGQPVSLANLKAMYQIAKKY
FT                   DIPVVMDSARFAENAYFIQQREKAYKNWTIEAITRESYKYADMLAMSAKKDAMVPMGGL
FT                   LSFKDDSFFDVYTDCRTLCVVQEGFPTYGGLEGGAMERLAVGLYDGMNQDWLAYRISQI
FT                   QYLVDGLESIGVTCQQAGGHAAFVDAGKLLPHIPAHQFPAQALACELYKVAGIRAVEIG
FT                   SFLLGRDPKSGEQLPCPAELLRLTVPRATYTQTHMDFIIEAFEHVKENASNIKGLAFTY
FT                   EPKVLRHFTAKLKEIS"
     MMMNNFRHLP EPFRIRVIEP VKRTTREHRD AAMIKAGMNP FLLNSEDVFI DLLTDSGTGA        60
     VTQNMQAAMM RGDESYSGSR SYYALAEAVK AIFGYAYTIP THQGRGAEQI YIPVLIKKRE       120
     QEKGLDRTKM VAFSNYFFDT TQGHSQINGC TVRNVYIKEA FDTAVRHDFK GDFDLERLEK       180
     GIQDVGAENV PYIVATITCN SAGGQPVSLA NLKAMYQIAK KYDIPVVMDS ARFAENAYFI       240
     QQREKAYKNW TIEAITRESY KYADMLAMSA KKDAMVPMGG LLSFKDDSFF DVYTDCRTLC       300
     VVQEGFPTYG GLEGGAMERL AVGLYDGMNQ DWLAYRISQI QYLVDGLESI GVTCQQAGGH       360
     AAFVDAGKLL PHIPAHQFPA QALACELYKV AGIRAVEIGS FLLGRDPKSG EQLPCPAELL       420
     RLTVPRATYT QTHMDFIIEA FEHVKENASN IKGLAFTYEP KVLRHFTAKL KEIS             474
//

If you have problems or comments...

PBIL Back to PBIL home page