(data stored in SCRATCH zone)

EMBL: CP001875.WZZE

CP001875.WZZE        Location/Qualifiers
FT   CDS             170902..171951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzzE"
FT                   /locus_tag="PANA_0148"
FT                   /product="WzzE"
FT                   /note="Lipopolysaccharide biosynthesis protein WzzE;
FT                   Similar to Pantoea sp. At-9b, lipopolysaccharide
FT                   biosynthesis protein (NCBI: ZP_05730663.1); COG: Cell
FT                   wall/membrane/envelope biogenesis; Subcellular localization
FT                   as predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75315"
FT                   /db_xref="GOA:D4GGL4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGL4"
FT                   /protein_id="ADD75315.1"
FT                   /translation="MRANVVENELDIRGLGCSLWRGKRWIVGCAIVFALVAWIATLLMK
FT                   QVWSTTAITGRPTVNMLGSYYSQQQFLNNLDMRNNALTLNTASPTVMDEVYQEFLMQLS
FT                   SWDTRREFWQQTDYYKTRKSGNAHNDAALLDDMIDNIQFTPADSARNIFDSVKLKAETA
FT                   ADANNLLRQYIAYASERAARHLNAELTGAWQARTSQLKAQVKRQEDVANAVFLRRQHRL
FT                   EQALKIASQQGINEKQTREVSENLADSDLFLMGQPLLQGQLETLRATGPSFDISYDQNK
FT                   AMLTTLDAGPTLNSKFQTYRYLRTPEEPVSRDSPRRAFMMVMWGAVGALVGAGVALARR
FT                   QRPMSDTQD"
     MRANVVENEL DIRGLGCSLW RGKRWIVGCA IVFALVAWIA TLLMKQVWST TAITGRPTVN        60
     MLGSYYSQQQ FLNNLDMRNN ALTLNTASPT VMDEVYQEFL MQLSSWDTRR EFWQQTDYYK       120
     TRKSGNAHND AALLDDMIDN IQFTPADSAR NIFDSVKLKA ETAADANNLL RQYIAYASER       180
     AARHLNAELT GAWQARTSQL KAQVKRQEDV ANAVFLRRQH RLEQALKIAS QQGINEKQTR       240
     EVSENLADSD LFLMGQPLLQ GQLETLRATG PSFDISYDQN KAMLTTLDAG PTLNSKFQTY       300
     RYLRTPEEPV SRDSPRRAFM MVMWGAVGAL VGAGVALARR QRPMSDTQD                   349
//

If you have problems or comments...

PBIL Back to PBIL home page