(data stored in SCRATCH zone)

EMBL: CP001875.XYLB

CP001875.XYLB        Location/Qualifiers
FT   CDS             complement(39582..41027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="PANA_0038"
FT                   /product="XylB"
FT                   /note="Xylulose kinase; Similar to Pantoea sp. At-9b,
FT                   xylulokinase (NCBI: ZP_05729686.1); COG: Carbohydrate
FT                   transport and metabolism; Subcellular localization as
FT                   predicted by Psort 2.0: Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75205"
FT                   /db_xref="GOA:D4GFU1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFU1"
FT                   /protein_id="ADD75205.1"
FT                   /translation="MVIGIDIGTSGVKVVLLDEQGVVVAVETSPLTVSRPQPLWSEQDP
FT                   ESWWLATDRAIQALTQQHDLSGVKAIGLTGQMHGATLLDAQHQVLRPAILWNDGRSGDQ
FT                   CRELEQRVPESRQITGNLMMPGFTAPKLLWLKEHEPDVFAQVAKVLLPKDYLRWRLSGE
FT                   FASDMSDAAGTMWLDVEKRDWSEVMLAACGLARHHMPALFEGNQITGALSADIAQRWKL
FT                   PQVPLVAGGGDNAAGAVGVGMTAPGQGMLSLGTSGVYFVVSDGYLSNPQRAVHSFCHAL
FT                   PQRWHLMSVMLSAASCLDWAAALTGCDDVPHLLSEAERAKQDAPPLWFLPYLSGERTPH
FT                   NNPHACGSFFGFTHQHGRPELAQAVLEGVGFALAEGMDVVHECGVTPSSIMLIGGGARS
FT                   GYWRQMLADISGQTLDYCEGGDVGPALGAARLAQMALDENLTVPALKQVQRHQPDPARH
FT                   AHYQPRRETFSRLYQQLLPLMQQ"
     MVIGIDIGTS GVKVVLLDEQ GVVVAVETSP LTVSRPQPLW SEQDPESWWL ATDRAIQALT        60
     QQHDLSGVKA IGLTGQMHGA TLLDAQHQVL RPAILWNDGR SGDQCRELEQ RVPESRQITG       120
     NLMMPGFTAP KLLWLKEHEP DVFAQVAKVL LPKDYLRWRL SGEFASDMSD AAGTMWLDVE       180
     KRDWSEVMLA ACGLARHHMP ALFEGNQITG ALSADIAQRW KLPQVPLVAG GGDNAAGAVG       240
     VGMTAPGQGM LSLGTSGVYF VVSDGYLSNP QRAVHSFCHA LPQRWHLMSV MLSAASCLDW       300
     AAALTGCDDV PHLLSEAERA KQDAPPLWFL PYLSGERTPH NNPHACGSFF GFTHQHGRPE       360
     LAQAVLEGVG FALAEGMDVV HECGVTPSSI MLIGGGARSG YWRQMLADIS GQTLDYCEGG       420
     DVGPALGAAR LAQMALDENL TVPALKQVQR HQPDPARHAH YQPRRETFSR LYQQLLPLMQ       480
     Q                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page