(data stored in SCRATCH zone)

EMBL: CP001875.XYLG

CP001875.XYLG        Location/Qualifiers
FT   CDS             43741..45261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylG"
FT                   /locus_tag="PANA_0041"
FT                   /product="XylG"
FT                   /note="D-xylose transport ATP-binding protein XylG; Similar
FT                   to Pantoea sp. At-9b, D-xylose ABC transporter, ATPase
FT                   subunit (NCBI: ZP_05729683.1); COG: Carbohydrate transport
FT                   and metabolism; Subcellular localization as predicted by
FT                   Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75208"
FT                   /db_xref="GOA:D4GFU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GFU4"
FT                   /protein_id="ADD75208.1"
FT                   /translation="MLLEMKNITKRFGAVKALDNVSLQLDAGEVLSLCGENGSGKSTLM
FT                   KILCGLYPHGDFDGQIRFAGEDIQAQTIRDTERKGIVIIHQELALVRQLTVMENIFLGA
FT                   ELGRFGMVDDETMTLRCQQLLERVKLNVSPDTRVGELGLGQQQLVEIARALNKQVRLLI
FT                   LDEPTSSLTEQETTVLLSIIQNLREHGIACVYISHKLNEVKAISDTICVIRDGQHIATR
FT                   PAAGLSEDDIITMMVGRELTALYPHSPHDIGDTVLQVDNLTAWHPVNRHVKRVNNVSFT
FT                   LRKGEILGIAGLVGAGRTETVQCLFGVWPGRWQGDIAINGQKVTIRGCQHAIAHGIAMV
FT                   PEDRKKDGIVPLMGVGKNITLAALDQFSHRLSTLDEAEELRAINAAIARLRVKTSSPEL
FT                   PIGRLSGGNQQKAILAKCLLLNPKILILDEPTRGIDVGARQEIYVLINALVKQGISVIV
FT                   ISSELPEVLGLSDRILVMHEGQIKADLINDNLTQEQVMEAALRSEHYA"
     MLLEMKNITK RFGAVKALDN VSLQLDAGEV LSLCGENGSG KSTLMKILCG LYPHGDFDGQ        60
     IRFAGEDIQA QTIRDTERKG IVIIHQELAL VRQLTVMENI FLGAELGRFG MVDDETMTLR       120
     CQQLLERVKL NVSPDTRVGE LGLGQQQLVE IARALNKQVR LLILDEPTSS LTEQETTVLL       180
     SIIQNLREHG IACVYISHKL NEVKAISDTI CVIRDGQHIA TRPAAGLSED DIITMMVGRE       240
     LTALYPHSPH DIGDTVLQVD NLTAWHPVNR HVKRVNNVSF TLRKGEILGI AGLVGAGRTE       300
     TVQCLFGVWP GRWQGDIAIN GQKVTIRGCQ HAIAHGIAMV PEDRKKDGIV PLMGVGKNIT       360
     LAALDQFSHR LSTLDEAEEL RAINAAIARL RVKTSSPELP IGRLSGGNQQ KAILAKCLLL       420
     NPKILILDEP TRGIDVGARQ EIYVLINALV KQGISVIVIS SELPEVLGLS DRILVMHEGQ       480
     IKADLINDNL TQEQVMEAAL RSEHYA                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page