(data stored in SCRATCH zone)

EMBL: CP001875.YHBC

CP001875.YHBC        Location/Qualifiers
FT   CDS             525248..525712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbC"
FT                   /locus_tag="PANA_0455"
FT                   /product="YhbC"
FT                   /note="Hypothetical UPF0090 protein YhbC; Similar to
FT                   Erwinia tasmaniensis Et1/99, YhbC-like protein (NCBI:
FT                   YP_001906299.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75622"
FT                   /db_xref="GOA:D4GI92"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D4GI92"
FT                   /protein_id="ADD75622.1"
FT                   /translation="MGVGLSTLEQKLTELVSAPVEALGYELVGIEFVRGRTSTLRIYID
FT                   SEDGINVDDCADVSHQVSAVMDVEDPITVPYHLEVSSPGLDRPLFTAEHYARFTGDEVS
FT                   LVLRMAVQNRRKWQGIIKSVEGEMITVNVEGNDEVFALSNIQKANLVPHF"
     MGVGLSTLEQ KLTELVSAPV EALGYELVGI EFVRGRTSTL RIYIDSEDGI NVDDCADVSH        60
     QVSAVMDVED PITVPYHLEV SSPGLDRPLF TAEHYARFTG DEVSLVLRMA VQNRRKWQGI       120
     IKSVEGEMIT VNVEGNDEVF ALSNIQKANL VPHF                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page