(data stored in SCRATCH zone)

EMBL: CP001875.YHJH

CP001875.YHJH        Location/Qualifiers
FT   CDS             159281..160087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjH"
FT                   /locus_tag="PANA_0139"
FT                   /product="YhjH"
FT                   /note="Sensory Box/GGDEF Family Protein; Similar to Pantoea
FT                   sp. At-9b, diguanylate phosphodiesterase (NCBI:
FT                   ZP_05730653.1); COG: Cell wall/membrane/envelope
FT                   biogenesis; Subcellular localization as predicted by Psort
FT                   2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75306"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGK5"
FT                   /protein_id="ADD75306.1"
FT                   /translation="MKALTINQEKTMVMENFSQWLPSSIDINPQQKKRLIWQQCQRSYT
FT                   FQPIYKVSGQLLAIELLTAITHPSEPEKKLSPEAYFSELEIAQRLDIVQEQLELLTQWE
FT                   SFFGRNNVMASVNIDGPSLSLIQNHVPIRSLITRLPWVRFELTEHHVLPQEEMVAQMPE
FT                   LGPLWLDDFGSGMANFSALTELKYDYIKLSRELFILLRASDEGRILFPMLLSLINRYCN
FT                   GVIVEGVETQQEWDQVKSSPAMAAQGYFFSRPAPFSELESLPVQLD"
     MKALTINQEK TMVMENFSQW LPSSIDINPQ QKKRLIWQQC QRSYTFQPIY KVSGQLLAIE        60
     LLTAITHPSE PEKKLSPEAY FSELEIAQRL DIVQEQLELL TQWESFFGRN NVMASVNIDG       120
     PSLSLIQNHV PIRSLITRLP WVRFELTEHH VLPQEEMVAQ MPELGPLWLD DFGSGMANFS       180
     ALTELKYDYI KLSRELFILL RASDEGRILF PMLLSLINRY CNGVIVEGVE TQQEWDQVKS       240
     SPAMAAQGYF FSRPAPFSEL ESLPVQLD                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page