(data stored in SCRATCH zone)

EMBL: CP001875.YHJQ

CP001875.YHJQ        Location/Qualifiers
FT   CDS             139782..140585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjQ"
FT                   /locus_tag="PANA_0127"
FT                   /product="YhjQ"
FT                   /note="Cellulose Biosynthesis Protein; Similar to Pantoea
FT                   sp. At-9b, cellulose synthase operon protein YhjQ (NCBI:
FT                   ZP_05732368.1); COG: DNA replication, recombination and
FT                   repair; Subcellular localization as predicted by Psort 2.0:
FT                   Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75294"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGJ3"
FT                   /protein_id="ADD75294.1"
FT                   /translation="MPLVCVCSPKGGVGKTTLAANLAWSLARSGSKVLAIDFDVQNALR
FT                   LHFGVPLHDGRGFVARSEEQADWSQSILTTGGNIFVLPYGNVTESQRERFEENLTKDPH
FT                   FIKRGLDTLLNYPGLVMVADFPPGPGPALKAIKTLADMHLVVMLADTASVSLLPHIEEN
FT                   RLIGQPLNSKHGHYFVLNQCDNRRNINRDVTAFIQQRLGDNLLGQIHRDESVGEANASQ
FT                   QSVYDFSPSSAAAFDIELIAKRVASILNVNVGNGEVQAQIHTSNY"
     MPLVCVCSPK GGVGKTTLAA NLAWSLARSG SKVLAIDFDV QNALRLHFGV PLHDGRGFVA        60
     RSEEQADWSQ SILTTGGNIF VLPYGNVTES QRERFEENLT KDPHFIKRGL DTLLNYPGLV       120
     MVADFPPGPG PALKAIKTLA DMHLVVMLAD TASVSLLPHI EENRLIGQPL NSKHGHYFVL       180
     NQCDNRRNIN RDVTAFIQQR LGDNLLGQIH RDESVGEANA SQQSVYDFSP SSAAAFDIEL       240
     IAKRVASILN VNVGNGEVQA QIHTSNY                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page