(data stored in SCRATCH zone)

EMBL: CP001875.YHJW

CP001875.YHJW        Location/Qualifiers
FT   CDS             129671..131362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhjW"
FT                   /locus_tag="PANA_0120"
FT                   /product="YhjW"
FT                   /note="Inner membrane protein YhjW; Similar to Pantoea sp.
FT                   At-9b, sulfatase (NCBI: ZP_05732361.1); COG: General
FT                   function prediction only; Subcellular localization as
FT                   predicted by Psort 2.0: Inner Membrane"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75287"
FT                   /db_xref="GOA:D4GGI6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:D4GGI6"
FT                   /protein_id="ADD75287.1"
FT                   /translation="MNYIKSLTQQKLSLLLALYLGIFLNLPIFYRRFDGFLTRSTVTNW
FT                   LTAFTEVVAIVVLTFFLMRLLSLGGKWFYRILATLIVLISVAAGYYMAFFNVVIGYGIV
FT                   ASVMTTDTDLSKEVVGYHFILWMVLVSALPLFMIWRNNLSMTLNEQLRTPGQRLKPTLI
FT                   MLACVALVWLPIRYFDKLQKANEEVTNVDLPSYGGIVAHSYLPSNWLAALGLFTWTKID
FT                   ETLENQELLDPAQKYTYVAPPGLDDTYVVFVIGETTRWDHMGLLGYERNTTPKLSKEKN
FT                   LVAFRGESCDTATKLSLRCMFVREGGTMDNPGRTLKEQNVFAVMKELGFTSELFAMQSE
FT                   VWFYDNINANNFSFREQIGSEPRNQGKSVDDMLLVPELQASLQRYPKGKHLVVLHTKGS
FT                   HYLYSQRYPRSFARYQPECMGVDETCSKAQLINAYDNSVLYVDSMLDSVLDQLRDKKAI
FT                   VFYASDHGESISDNMHLHGTPREMAPPEQFRVPMMVWASDKYLADPTNRGNFERLQAQQ
FT                   RVGKTHRHVELFDTIMGCLGYTSPNGGIKQANNWCQAPAGTASKAL"
     MNYIKSLTQQ KLSLLLALYL GIFLNLPIFY RRFDGFLTRS TVTNWLTAFT EVVAIVVLTF        60
     FLMRLLSLGG KWFYRILATL IVLISVAAGY YMAFFNVVIG YGIVASVMTT DTDLSKEVVG       120
     YHFILWMVLV SALPLFMIWR NNLSMTLNEQ LRTPGQRLKP TLIMLACVAL VWLPIRYFDK       180
     LQKANEEVTN VDLPSYGGIV AHSYLPSNWL AALGLFTWTK IDETLENQEL LDPAQKYTYV       240
     APPGLDDTYV VFVIGETTRW DHMGLLGYER NTTPKLSKEK NLVAFRGESC DTATKLSLRC       300
     MFVREGGTMD NPGRTLKEQN VFAVMKELGF TSELFAMQSE VWFYDNINAN NFSFREQIGS       360
     EPRNQGKSVD DMLLVPELQA SLQRYPKGKH LVVLHTKGSH YLYSQRYPRS FARYQPECMG       420
     VDETCSKAQL INAYDNSVLY VDSMLDSVLD QLRDKKAIVF YASDHGESIS DNMHLHGTPR       480
     EMAPPEQFRV PMMVWASDKY LADPTNRGNF ERLQAQQRVG KTHRHVELFD TIMGCLGYTS       540
     PNGGIKQANN WCQAPAGTAS KAL                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page