(data stored in SCRATCH zone)

EMBL: CP001875.YJGF

CP001875.YJGF        Location/Qualifiers
FT   CDS             complement(569531..569920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjgF"
FT                   /locus_tag="PANA_0486"
FT                   /product="YjgF"
FT                   /note="UPF0076 protein YjgF; Similar to Pantoea sp. At-9b,
FT                   endoribonuclease L-PSP (NCBI: ZP_05730022.1); COG:
FT                   Translation, ribosomal structure and biogenesis;
FT                   Subcellular localization as predicted by Psort 2.0:
FT                   Cytoplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75653"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIQ8"
FT                   /protein_id="ADD75653.1"
FT                   /translation="MMSREISTEKAPAAIGPYVQGVDLGSMIITSGQIPVNPATGDVAE
FT                   DVSAQARQSLENVKAIVEAAGLKVADIVKTTVFVKDLNDFATVNATYEAFFTEHNAPFP
FT                   ARSCVEVARLPKDVKIEIEAIALRR"
     MMSREISTEK APAAIGPYVQ GVDLGSMIIT SGQIPVNPAT GDVAEDVSAQ ARQSLENVKA        60
     IVEAAGLKVA DIVKTTVFVK DLNDFATVNA TYEAFFTEHN APFPARSCVE VARLPKDVKI       120
     EIEAIALRR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page