(data stored in SCRATCH zone)

EMBL: CP001875.YJIN

CP001875.YJIN        Location/Qualifiers
FT   CDS             complement(595320..596609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjiN"
FT                   /locus_tag="PANA_0512"
FT                   /product="YjiN"
FT                   /note="Possible Conserved Transmembrane Protein; Similar to
FT                   Pantoea sp. At-9b, protein of unknown function DUF445
FT                   (NCBI: ZP_05730034.1); COG: Unknown Function; Subcellular
FT                   localization as predicted by Psort 2.0: Unknown"
FT                   /db_xref="EnsemblGenomes-Gn:PANA_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD75679"
FT                   /db_xref="GOA:D4GIT4"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D4GIT4"
FT                   /protein_id="ADD75679.1"
FT                   /translation="MDKQRELKRTKRLALSLLLLAAATFVVTLFLPPNFYVSGIKAIAE
FT                   AAMVGALADWFAVVALFRRVPVPFIARHTAIIPRNKDRIGENLGRFVQEKFLDTDSMLN
FT                   LIRRHDPSQMLATWLSAPGNADRIGRHLLQVMRGFLDLTDDARIQHFMRRAVHKAIDKV
FT                   DLSQSGALMLESLTKNNRHQELLDAAVEQLLRLLHKPSTREFIASQLVRWLKREHPIKA
FT                   KMLPTEWLGEHSAELVANAVDSLLDDVALDQGHELRLGFNRAVDRLIEKLKNDPEMAER
FT                   AEVIKGWLKDDPTLNRYIGELWGDLRDWLKADLNSEASKVQDKVRQAALWLGETLAADE
FT                   GLRSSMNQHLEDAARSVAPEFAAFLTRHISDTVKSWDARDMSQQIELNIGKDLQFIRIN
FT                   GTLVGGTIGLILYLLSQIPAVLPVVKGWLA"
     MDKQRELKRT KRLALSLLLL AAATFVVTLF LPPNFYVSGI KAIAEAAMVG ALADWFAVVA        60
     LFRRVPVPFI ARHTAIIPRN KDRIGENLGR FVQEKFLDTD SMLNLIRRHD PSQMLATWLS       120
     APGNADRIGR HLLQVMRGFL DLTDDARIQH FMRRAVHKAI DKVDLSQSGA LMLESLTKNN       180
     RHQELLDAAV EQLLRLLHKP STREFIASQL VRWLKREHPI KAKMLPTEWL GEHSAELVAN       240
     AVDSLLDDVA LDQGHELRLG FNRAVDRLIE KLKNDPEMAE RAEVIKGWLK DDPTLNRYIG       300
     ELWGDLRDWL KADLNSEASK VQDKVRQAAL WLGETLAADE GLRSSMNQHL EDAARSVAPE       360
     FAAFLTRHIS DTVKSWDARD MSQQIELNIG KDLQFIRING TLVGGTIGLI LYLLSQIPAV       420
     LPVVKGWLA                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page