(data stored in SCRATCH zone)

EMBL: CP001887.PE10

CP001887.PE10        Location/Qualifiers
FT   CDS             9373..9804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00050"
FT                   /product="hypothetical protein"
FT                   /note="COG1426 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17698"
FT                   /protein_id="ADH17698.1"
FT                   /translation="MSEHVHKELLHLGEVFRSQREERALSLKDVEAATSIRLSALEAIE
FT                   AGHLGKLISPVYAQGFMKKYAAFLDMDGDRLLKEHPYVLKIFQEFSDQNMDMLLDLESM
FT                   GGRNSPEKAIRSWLNLGWAGVFVVGAACIWWLGNLFNLF"
     MSEHVHKELL HLGEVFRSQR EERALSLKDV EAATSIRLSA LEAIEAGHLG KLISPVYAQG        60
     FMKKYAAFLD MDGDRLLKEH PYVLKIFQEF SDQNMDMLLD LESMGGRNSP EKAIRSWLNL       120
     GWAGVFVVGA ACIWWLGNLF NLF                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page