(data stored in SCRATCH zone)

EMBL: CP001887.PE108

CP001887.PE108       Location/Qualifiers
FT   CDS             complement(122603..123514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00550"
FT                   /product="pseudouridine synthetase family protein"
FT                   /note="COG0564 Pseudouridylate synthases, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17796"
FT                   /protein_id="ADH17796.1"
FT                   /translation="MQEFIGTADRQIRLSSFLRTSLPHLPKKTILESVRYHGCRVNGRI
FT                   ERFESYKLQPGDRVSLQIIEHSSPQLLWEDEHLCIYNKPAKQTSEDLAHQLNVHLVHRL
FT                   DRDTSGCILFAKHAKASSLITQLFKNREIDKRYIALVFGQPRQESGIITTYTAPCYRRI
FT                   GAVLFGNTDQNSGKITITKWEILTRYPKYTLLLCRPVTGRTHQIRLHMKTIGHPIVGDV
FT                   DYGNQEQPKNVVRTLLHAASLAFISPFSNEKIEVSSLTPSQDPYPFYADFSLKPLKKPP
FT                   INKVVLIQVVLEAKDSVSKRIV"
     MQEFIGTADR QIRLSSFLRT SLPHLPKKTI LESVRYHGCR VNGRIERFES YKLQPGDRVS        60
     LQIIEHSSPQ LLWEDEHLCI YNKPAKQTSE DLAHQLNVHL VHRLDRDTSG CILFAKHAKA       120
     SSLITQLFKN REIDKRYIAL VFGQPRQESG IITTYTAPCY RRIGAVLFGN TDQNSGKITI       180
     TKWEILTRYP KYTLLLCRPV TGRTHQIRLH MKTIGHPIVG DVDYGNQEQP KNVVRTLLHA       240
     ASLAFISPFS NEKIEVSSLT PSQDPYPFYA DFSLKPLKKP PINKVVLIQV VLEAKDSVSK       300
     RIV                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page