(data stored in SCRATCH zone)

EMBL: CP001887.PE120

CP001887.PE120       Location/Qualifiers
FT   CDS             136317..136820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00610"
FT                   /product="inclusion membrane protein G"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17808"
FT                   /protein_id="ADH17808.1"
FT                   /translation="MICCDKVLSSVQSMPVIDKCSVTKCLQTAKQAAVLALSLFAVFAS
FT                   GSLSILSAAVLFSGTAAVLPYLLILTTALLGFVCAVIVLLRNLSAVVQSCKKRSPEEIE
FT                   GAARPSDQQESGGRLSEESASPQASPTSSTFGLESALRSIGDSVSGAFDDINKDNSRSR
FT                   SHSF"
     MICCDKVLSS VQSMPVIDKC SVTKCLQTAK QAAVLALSLF AVFASGSLSI LSAAVLFSGT        60
     AAVLPYLLIL TTALLGFVCA VIVLLRNLSA VVQSCKKRSP EEIEGAARPS DQQESGGRLS       120
     EESASPQASP TSSTFGLESA LRSIGDSVSG AFDDINKDNS RSRSHSF                     167
//

If you have problems or comments...

PBIL Back to PBIL home page