(data stored in SCRATCH zone)

EMBL: CP001887.PE160

CP001887.PE160       Location/Qualifiers
FT   CDS             complement(184313..184816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00825"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17848"
FT                   /protein_id="ADH17848.1"
FT                   /translation="MTEQPHRLSEEARSIANEAKERLLKLNDKPELSRPYLVKGFLSKI
FT                   SRGISSKEAVSKFSTAIVTSLLGYLWNHILQNKERILSADARDLEARSVLLDTKEILAL
FT                   CKYFAINRCTWLSSSSTQEEENLICQDIAKEMFSISLHALVEQQWIREYDLSVNNGSSY
FT                   KLFF"
     MTEQPHRLSE EARSIANEAK ERLLKLNDKP ELSRPYLVKG FLSKISRGIS SKEAVSKFST        60
     AIVTSLLGYL WNHILQNKER ILSADARDLE ARSVLLDTKE ILALCKYFAI NRCTWLSSSS       120
     TQEEENLICQ DIAKEMFSIS LHALVEQQWI REYDLSVNNG SSYKLFF                     167
//

If you have problems or comments...

PBIL Back to PBIL home page