(data stored in SCRATCH zone)

EMBL: CP001887.PE165

CP001887.PE165       Location/Qualifiers
FT   CDS             189320..190963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17853"
FT                   /protein_id="ADH17853.1"
FT                   /translation="MPDKNSEAGQNSLIQQGKYVDAIQKKLPASSQAQPKQAKAKEQKA
FT                   EEKPKTTPIEGVLETIKTEFKGHRVPVEKIIHGIWIAGAPPDGIEDYMRVFLDTYEGFD
FT                   FYFWVDENAYAAAKFSSILKKVAFDAAIQDLRSATDESTKAFVKDYDELKQKYEKKVAE
FT                   TTSQAEKDQYLKDLKDLLEKFTKISDEIRGKFDRLFLKNVIVAQNGFFNFCLLKGLGNI
FT                   NDETRAEYLEKELKLPTEEIEQYKKLKETNKEKIAAIVKQLNEKLGSDRVKIKDIKELQ
FT                   SMKQARNVYNYEQEMFLRWNYAAATDQIRMYMLEELGGLYTDLDMMPSYSQEVLELIKK
FT                   HSDGNRMFEDMSSRRAISDAVLKMAVGKATTVSMEEVAKDIDVSRLTEEDKTKLNALFK
FT                   DLEPFAKPDSKGAEAEGGEGAKGMKKSFFQPIDLNIVRNTMPILRRYHHYPELGWFIRG
FT                   LNGLMVSHKGSTAVSAVIVGQQAAYQELAALRQDVLSGEFFHSLENLTHRNHKERIGNH
FT                   LVANYLAKSLFFDYCQDSVMPEAVSTLGIR"
     MPDKNSEAGQ NSLIQQGKYV DAIQKKLPAS SQAQPKQAKA KEQKAEEKPK TTPIEGVLET        60
     IKTEFKGHRV PVEKIIHGIW IAGAPPDGIE DYMRVFLDTY EGFDFYFWVD ENAYAAAKFS       120
     SILKKVAFDA AIQDLRSATD ESTKAFVKDY DELKQKYEKK VAETTSQAEK DQYLKDLKDL       180
     LEKFTKISDE IRGKFDRLFL KNVIVAQNGF FNFCLLKGLG NINDETRAEY LEKELKLPTE       240
     EIEQYKKLKE TNKEKIAAIV KQLNEKLGSD RVKIKDIKEL QSMKQARNVY NYEQEMFLRW       300
     NYAAATDQIR MYMLEELGGL YTDLDMMPSY SQEVLELIKK HSDGNRMFED MSSRRAISDA       360
     VLKMAVGKAT TVSMEEVAKD IDVSRLTEED KTKLNALFKD LEPFAKPDSK GAEAEGGEGA       420
     KGMKKSFFQP IDLNIVRNTM PILRRYHHYP ELGWFIRGLN GLMVSHKGST AVSAVIVGQQ       480
     AAYQELAALR QDVLSGEFFH SLENLTHRNH KERIGNHLVA NYLAKSLFFD YCQDSVMPEA       540
     VSTLGIR                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page