(data stored in SCRATCH zone)

EMBL: CP001887.PE170

CP001887.PE170       Location/Qualifiers
FT   CDS             193407..194585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_00875"
FT                   /product="tryptophan synthase subunit beta"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG0133 Tryptophan synthase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_00875"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17858"
FT                   /protein_id="ADH17858.1"
FT                   /translation="MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCIL
FT                   KNYAGRQTPLTEVKNFARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVV
FT                   AETGAGQHGVATATACAYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGL
FT                   KDAVNQALQDWATTHSFTHYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPD
FT                   ILIACIGGGSNAIGFFHHFIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYS
FT                   YLLQDDDGQVLQTHSISAGLDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNE
FT                   GIIPALESSHALAHLVSIAPSLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE"
     MFKHKHPFGG AFLPEELLAP IQNLKAEWEI LKTQQSFLSE LDCILKNYAG RQTPLTEVKN        60
     FARAIDGPRV FLKREDLLHT GAHKLNNALG QCLLAKYLGK TRVVAETGAG QHGVATATAC       120
     AYLGLDCVVY MGAKDVERQK PNVEKMRFLG AEVVSVTKGS CGLKDAVNQA LQDWATTHSF       180
     THYCLGSALG PLPYPDIVRF FQSVISAEVK EQIHAVAGRD PDILIACIGG GSNAIGFFHH       240
     FIPNPKVQLI GVEGGGLGIS SGKHAARFAT GRPGVFHGFY SYLLQDDDGQ VLQTHSISAG       300
     LDYPSVGPDH AEMHESGRAF YTLATDEEAL RAFFLLTRNE GIIPALESSH ALAHLVSIAP       360
     SLPKEQIVIV NLSGRGDKDL PQIIRRNRGI YE                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page