(data stored in SCRATCH zone)

EMBL: CP001887.PE218

CP001887.PE218       Location/Qualifiers
FT   CDS             246524..247288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01115"
FT                   /product="hypothetical protein"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17906"
FT                   /protein_id="ADH17906.1"
FT                   /translation="MFTLQCSPPWTKLGKRVESLVRKALYTHAMLQKHTRIAVALSGGK
FT                   DSLSLLLMLKAISGRGFPELTIHAIHIGGKYSCGAAVSGNYLSSICDKIQVPLISIPSP
FT                   YETENPECYTCSRIRRRLLFDTAKAVGATAVAFGHHRDDVVQTTLMNLLHKAEFAGMLP
FT                   IVDMVNFGITILRPLIFIPEDLIRKFAKESGFARITCRCPVISLRTKTEEALKTLETIF
FT                   PQARHNIALAVRETGLSKANRVEQYDSLLTEA"
     MFTLQCSPPW TKLGKRVESL VRKALYTHAM LQKHTRIAVA LSGGKDSLSL LLMLKAISGR        60
     GFPELTIHAI HIGGKYSCGA AVSGNYLSSI CDKIQVPLIS IPSPYETENP ECYTCSRIRR       120
     RLLFDTAKAV GATAVAFGHH RDDVVQTTLM NLLHKAEFAG MLPIVDMVNF GITILRPLIF       180
     IPEDLIRKFA KESGFARITC RCPVISLRTK TEEALKTLET IFPQARHNIA LAVRETGLSK       240
     ANRVEQYDSL LTEA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page