(data stored in SCRATCH zone)

EMBL: CP001887.PE241

CP001887.PE241       Location/Qualifiers
FT   CDS             complement(266492..267475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01230"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase III"
FT                   /EC_number="2.3.1.180"
FT                   /note="COG0332 3-oxoacyl-[acyl-carrier-protein] synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17929"
FT                   /protein_id="ADH17929.1"
FT                   /translation="MRASIWGTGSYLPKKILTNADLEKIVETSDEWISTRTGIKERRIA
FT                   SAEEFSSFMGAKAAEKAIEAAKISKSQVDCIVFSTAAPDYIFPSSAALAQAYLGIKEIP
FT                   AFDCLAACTGFLYGLSIAKAYVESGMYQCVLVIAADKLSSFVNYQDRNTCVLFGDGGSA
FT                   CIVGHSRPGALEISKVNLGADGKQGDLLRLPAGGSRCPASQDTVQNHQHFITMEGKEVF
FT                   KHAVRRMEFAAKTCITEAGLQEKDIDWLVPHQANERIIDAIAKRFAVKDSRVFKTLAKY
FT                   GNTAASSVGIALDELLRTHDIHVAERLLLVAFGGGLSWGAVILQQV"
     MRASIWGTGS YLPKKILTNA DLEKIVETSD EWISTRTGIK ERRIASAEEF SSFMGAKAAE        60
     KAIEAAKISK SQVDCIVFST AAPDYIFPSS AALAQAYLGI KEIPAFDCLA ACTGFLYGLS       120
     IAKAYVESGM YQCVLVIAAD KLSSFVNYQD RNTCVLFGDG GSACIVGHSR PGALEISKVN       180
     LGADGKQGDL LRLPAGGSRC PASQDTVQNH QHFITMEGKE VFKHAVRRME FAAKTCITEA       240
     GLQEKDIDWL VPHQANERII DAIAKRFAVK DSRVFKTLAK YGNTAASSVG IALDELLRTH       300
     DIHVAERLLL VAFGGGLSWG AVILQQV                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page