(data stored in SCRATCH zone)

EMBL: CP001887.PE265

CP001887.PE265       Location/Qualifiers
FT   CDS             294392..294982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17953"
FT                   /protein_id="ADH17953.1"
FT                   /translation="MFKLLLIFADPAEAARTLSLFPFSLNKENFYTYHTENVLLDVMVL
FT                   KTWGYRGVVQALSPPPGGYDLWINAGFAGAGNPNIPLLKTYTITSVKELTPTTSVEEEL
FT                   EVTPIPRLPLAQLTSVRSPYRDGFHEHLQLVDMEGFFIAKQASLVACPCSMIKVSSDYT
FT                   TREGQDFLKNNKVKLSQKLAEAIFPIYSSFIDV"
     MFKLLLIFAD PAEAARTLSL FPFSLNKENF YTYHTENVLL DVMVLKTWGY RGVVQALSPP        60
     PGGYDLWINA GFAGAGNPNI PLLKTYTITS VKELTPTTSV EEELEVTPIP RLPLAQLTSV       120
     RSPYRDGFHE HLQLVDMEGF FIAKQASLVA CPCSMIKVSS DYTTREGQDF LKNNKVKLSQ       180
     KLAEAIFPIY SSFIDV                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page