(data stored in SCRATCH zone)

EMBL: CP001887.PE281

CP001887.PE281       Location/Qualifiers
FT   CDS             311075..312025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01430"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit C"
FT                   /note="COG2869 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase, subunit NqrC"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17969"
FT                   /protein_id="ADH17969.1"
FT                   /translation="MASKSRHYLNQPWYIILFIFVLSLIAGTLLSSVYYVLAPIQQQAA
FT                   EFDRNQQMLMAAQVISSDNTFQVYEKGDWHPALYNTKKQLLEISSTPPKVTVTTLSSYF
FT                   QNFVRVLLTDTQGNLSSFEDHNLNLEEFLSQPTPVIHGLALYVVYAILHNDAASSKLSA
FT                   SQVAKNPTAIESIVLPIEGFGLWGPIYGFLALEKDGNTVLGTSWYQHGETPGLGANIAN
FT                   PQWQKNFRGKKVFLVSASGETDFAKTTLGLEVIKGSVSAALGDSPKAASSIDGISGATL
FT                   TCNGVTESFSHSLAPYRALLTFFANSKPSGESHDH"
     MASKSRHYLN QPWYIILFIF VLSLIAGTLL SSVYYVLAPI QQQAAEFDRN QQMLMAAQVI        60
     SSDNTFQVYE KGDWHPALYN TKKQLLEISS TPPKVTVTTL SSYFQNFVRV LLTDTQGNLS       120
     SFEDHNLNLE EFLSQPTPVI HGLALYVVYA ILHNDAASSK LSASQVAKNP TAIESIVLPI       180
     EGFGLWGPIY GFLALEKDGN TVLGTSWYQH GETPGLGANI ANPQWQKNFR GKKVFLVSAS       240
     GETDFAKTTL GLEVIKGSVS AALGDSPKAA SSIDGISGAT LTCNGVTESF SHSLAPYRAL       300
     LTFFANSKPS GESHDH                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page