(data stored in SCRATCH zone)

EMBL: CP001887.PE282

CP001887.PE282       Location/Qualifiers
FT   CDS             312015..312656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01435"
FT                   /product="Na(+)-translocating NADH-quinone reductase
FT                   subunit D"
FT                   /note="COG1347 Na+-transporting NADH:ubiquinone
FT                   oxidoreductase, subunit NqrD"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17970"
FT                   /protein_id="ADH17970.1"
FT                   /translation="MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMG
FT                   FAVSFVTGCSSFVVSLLRKITPESVRMIAQLIIISLFVILIDQFLKAFFFTISKTLSVF
FT                   VGLIITNCIVMGRAESMARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTILGF
FT                   RVIPEILYTSAAHPDGYENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR"
     MTTNKSYLTY FTDALWINNQ PLIAILGICS ALAVTTTVTT ALTMGFAVSF VTGCSSFVVS        60
     LLRKITPESV RMIAQLIIIS LFVILIDQFL KAFFFTISKT LSVFVGLIIT NCIVMGRAES       120
     MARHVSPIPA FLDGLGSGLG YGWVLVCISI IRELFGFGTI LGFRVIPEIL YTSAAHPDGY       180
     ENLGLMVLAP SAFFLLGIMI WIVNIIRAPK TKR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page