(data stored in SCRATCH zone)

EMBL: CP001887.PE305

CP001887.PE305       Location/Qualifiers
FT   CDS             complement(340495..341010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17993"
FT                   /protein_id="ADH17993.1"
FT                   /translation="MVNHLLRLGLLSLLRYLLSFLRYCYSKWWAAAFSALCLGGCSQPA
FT                   LSSFLEFIDNDYTAAAHLGIDRGCVTESVGQQLVVTWGLPSRFRDSLPVVLHVWVYYGN
FT                   GEAAKFSYDVQHLSGYQVYTLKENDYQDRQGIISYKVSLTKDGKEILSRSHHLWMEVIS
FT                   LKAFSQLS"
     MVNHLLRLGL LSLLRYLLSF LRYCYSKWWA AAFSALCLGG CSQPALSSFL EFIDNDYTAA        60
     AHLGIDRGCV TESVGQQLVV TWGLPSRFRD SLPVVLHVWV YYGNGEAAKF SYDVQHLSGY       120
     QVYTLKENDY QDRQGIISYK VSLTKDGKEI LSRSHHLWME VISLKAFSQL S                171
//

If you have problems or comments...

PBIL Back to PBIL home page