(data stored in SCRATCH zone)

EMBL: CP001887.PE306

CP001887.PE306       Location/Qualifiers
FT   CDS             complement(340931..341356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01555"
FT                   /product="V-type ATP synthase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /note="COG0636 F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH17994"
FT                   /protein_id="ADH17994.1"
FT                   /translation="MIDVSVVGPVLAMALAMIGSAVGCGMAGVASHAVMSRIDEGHGKI
FT                   IGLSAMPSSQSIYGLIFMLLLNDAIKDGKVSAVSGIVMGIAVGSALLLSAFMQGKCCVS
FT                   AIQAYARSSAIYGKSFASIGIVESFALFAFVFALLLF"
     MIDVSVVGPV LAMALAMIGS AVGCGMAGVA SHAVMSRIDE GHGKIIGLSA MPSSQSIYGL        60
     IFMLLLNDAI KDGKVSAVSG IVMGIAVGSA LLLSAFMQGK CCVSAIQAYA RSSAIYGKSF       120
     ASIGIVESFA LFAFVFALLL F                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page