(data stored in SCRATCH zone)

EMBL: CP001887.PE362

CP001887.PE362       Location/Qualifiers
FT   CDS             complement(409953..410207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01840"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18050"
FT                   /protein_id="ADH18050.1"
FT                   /translation="MEILIQEAPDRWFGIFESEVVEGETGAYSKTEGFCTTGICFYYQT
FT                   KKFVNSLGREGLEEVSSSKPLHFTKKAYLPRLIKVKGYR"
     MEILIQEAPD RWFGIFESEV VEGETGAYSK TEGFCTTGIC FYYQTKKFVN SLGREGLEEV        60
     SSSKPLHFTK KAYLPRLIKV KGYR                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page