(data stored in SCRATCH zone)

EMBL: CP001887.PE365

CP001887.PE365       Location/Qualifiers
FT   CDS             complement(411046..411636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01855"
FT                   /product="hypothetical protein"
FT                   /note="COG1268 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01855"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18053"
FT                   /protein_id="ADH18053.1"
FT                   /translation="MVAKSITKEYSETLISNPFVKVIAGSLFLACLAKISISLPFTPVP
FT                   ITFQTLGVFCLGLVMTPQMAVTTVVAYLLEGLFFPVFCSPMCGIAVFCGPTAGYLFSFV
FT                   PAVALISWLYGKFGRSEARSWVVAMILFVGGGVSLCLGALWLACFLKSIGVSNSLDLVG
FT                   AFKIGVLPFLIGKIVKIALVVQGRSVRRLFIGK"
     MVAKSITKEY SETLISNPFV KVIAGSLFLA CLAKISISLP FTPVPITFQT LGVFCLGLVM        60
     TPQMAVTTVV AYLLEGLFFP VFCSPMCGIA VFCGPTAGYL FSFVPAVALI SWLYGKFGRS       120
     EARSWVVAMI LFVGGGVSLC LGALWLACFL KSIGVSNSLD LVGAFKIGVL PFLIGKIVKI       180
     ALVVQGRSVR RLFIGK                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page