(data stored in SCRATCH zone)

EMBL: CP001887.PE379

CP001887.PE379       Location/Qualifiers
FT   CDS             425071..426399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="G9768_01925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:G9768_01925"
FT                   /db_xref="EnsemblGenomes-Tr:ADH18067"
FT                   /protein_id="ADH18067.1"
FT                   /translation="MQAAHHHYHRYTDKLHRQNHKKDLISPKPTEQEACNTSSLSKELI
FT                   PLSEQRGLLSPICDFISERPCLHGVSVRNLKQALKNSAGTQIALDWSILPQWFNPRVSH
FT                   APKLSIRDFGYSAHQTVTEATPPCWQNCFNPSAAVTIYDSSYGKGVFQISYTLVRYWRE
FT                   NAATAGDAMMLAGSINDYPSRQNIFSQFTFSQNFPNERVSLTIGQYSLYAIDGTLYNND
FT                   QQLGFISYALSQNPTATYSSGSLGAYLQVAPTASTSLQIGFQDAYNISGSSIKWSNLTK
FT                   NRYNFHGFASWAPRCCLGSGQYSVLLYVTRQVPEQMEQTMGWSVNASQHISSKLYVFGR
FT                   YSGVTGHVFPINRTYSFGMASANLFNRNPQDLFGIACAFNNVHLSASPNTKRKYETVIE
FT                   GFATIGCGPYLSFAPDFQLYLYPALRPNKQSARVYSVRANLAI"
     MQAAHHHYHR YTDKLHRQNH KKDLISPKPT EQEACNTSSL SKELIPLSEQ RGLLSPICDF        60
     ISERPCLHGV SVRNLKQALK NSAGTQIALD WSILPQWFNP RVSHAPKLSI RDFGYSAHQT       120
     VTEATPPCWQ NCFNPSAAVT IYDSSYGKGV FQISYTLVRY WRENAATAGD AMMLAGSIND       180
     YPSRQNIFSQ FTFSQNFPNE RVSLTIGQYS LYAIDGTLYN NDQQLGFISY ALSQNPTATY       240
     SSGSLGAYLQ VAPTASTSLQ IGFQDAYNIS GSSIKWSNLT KNRYNFHGFA SWAPRCCLGS       300
     GQYSVLLYVT RQVPEQMEQT MGWSVNASQH ISSKLYVFGR YSGVTGHVFP INRTYSFGMA       360
     SANLFNRNPQ DLFGIACAFN NVHLSASPNT KRKYETVIEG FATIGCGPYL SFAPDFQLYL       420
     YPALRPNKQS ARVYSVRANL AI                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page